DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14645 and CG14244

Sequence 1:NP_652325.2 Gene:CG14645 FlyBaseID:FBgn0040687 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_652259.2 Gene:CG14244 FlyBaseID:FBgn0040607 Length:106 Species:Drosophila melanogaster

Alignment Length:84 Identity:34/85 (40%)
Similarity:40/85 (47%) Gaps:1/85 (1%)


  Fly    10 LLVISFGIALAYDGDGQPGCKTQAELDIVVFRNNWDATSYWKCETLNKPAIEIKCPSETGFMDSL 74
            ||::..||....:...:|||...|||.|.. |...|.|.||.|..:|..|...||...|||...|
  Fly    16 LLLLPSGIRSMCNDSTEPGCLHPAELQIPQ-RYCLDPTKYWLCSAINSQAHLHKCQPNTGFDQDL 79

  Fly    75 KNCVNWEEWEWEKPVEPLS 93
            ..||.|..|||:...||.|
  Fly    80 NACVPWTAWEWKPCQEPPS 98



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130813374
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20987
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.