DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14645 and CG14244

DIOPT Version :10

Sequence 1:NP_652325.2 Gene:CG14645 / 50160 FlyBaseID:FBgn0040687 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_652259.2 Gene:CG14244 / 50080 FlyBaseID:FBgn0040607 Length:106 Species:Drosophila melanogaster


Alignment Length:84 Identity:34/84 - (40%)
Similarity:40/84 - (47%) Gaps:1/84 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLVISFGIALAYDGDGQPGCKTQAELDIVVFRNNWDATSYWKCETLNKPAIEIKCPSETGFMDSL 74
            ||::..||....:...:|||...|||.|.. |...|.|.||.|..:|..|...||...|||...|
  Fly    16 LLLLPSGIRSMCNDSTEPGCLHPAELQIPQ-RYCLDPTKYWLCSAINSQAHLHKCQPNTGFDQDL 79

  Fly    75 KNCVNWEEWEWEKPVEPLS 93
            ..||.|..|||:...||.|
  Fly    80 NACVPWTAWEWKPCQEPPS 98

Return to query results.
Submit another query.