DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14645 and CG14246

DIOPT Version :10

Sequence 1:NP_652325.2 Gene:CG14645 / 50160 FlyBaseID:FBgn0040687 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_652260.1 Gene:CG14246 / 3772140 FlyBaseID:FBgn0040608 Length:93 Species:Drosophila melanogaster


Alignment Length:84 Identity:27/84 - (32%)
Similarity:43/84 - (51%) Gaps:15/84 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DGDGQPGCKTQAELDIVVFRNNWDATSYWKCE--------------TLNKPAIEIKCPSETGFMD 72
            |.:|:|||::..||. ..:|:.||.|:||:|.              ...:||...:||:...|.|
  Fly     5 DYNGEPGCRSAEELG-QSYRHFWDPTAYWQCGGKSMEEERERDRDWERERPAQLQRCPANELFYD 68

  Fly    73 SLKNCVNWEEWEWEKPVEP 91
            ..:.||.|:.|:|.:|.:|
  Fly    69 RERRCVKWKHWQWTEPQDP 87

Return to query results.
Submit another query.