DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14645 and CG14246

DIOPT Version :9

Sequence 1:NP_652325.2 Gene:CG14645 / 50160 FlyBaseID:FBgn0040687 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001287546.1 Gene:CG14246 / 3772140 FlyBaseID:FBgn0040608 Length:93 Species:Drosophila melanogaster


Alignment Length:84 Identity:27/84 - (32%)
Similarity:43/84 - (51%) Gaps:15/84 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DGDGQPGCKTQAELDIVVFRNNWDATSYWKCE--------------TLNKPAIEIKCPSETGFMD 72
            |.:|:|||::..||. ..:|:.||.|:||:|.              ...:||...:||:...|.|
  Fly     5 DYNGEPGCRSAEELG-QSYRHFWDPTAYWQCGGKSMEEERERDRDWERERPAQLQRCPANELFYD 68

  Fly    73 SLKNCVNWEEWEWEKPVEP 91
            ..:.||.|:.|:|.:|.:|
  Fly    69 RERRCVKWKHWQWTEPQDP 87



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449167
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26159
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20987
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.