DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14645 and CG14300

DIOPT Version :9

Sequence 1:NP_652325.2 Gene:CG14645 / 50160 FlyBaseID:FBgn0040687 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001014639.1 Gene:CG14300 / 3346166 FlyBaseID:FBgn0038643 Length:94 Species:Drosophila melanogaster


Alignment Length:92 Identity:33/92 - (35%)
Similarity:52/92 - (56%) Gaps:3/92 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVQLAL-TSLLVISFGIALAYDGDGQPGCKTQAELDIVVFRNNWDATSYWKCETLNKPAIEIKC 64
            ||..:|| .::|.|.....::.|. |:..||.::|:. ..:.:::||..||.||||..||.|:.|
  Fly     1 MKSVVALFATVLAIILVAGVSADA-GRSACKDESEIG-QTYTHHFDAAKYWLCETLGVPATEVDC 63

  Fly    65 PSETGFMDSLKNCVNWEEWEWEKPVEP 91
            |:...:|..||.|:.|..:.|:||..|
  Fly    64 PAGLAYMHLLKECIPWASYIWKKPEMP 90



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014365
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20987
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.