DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sf3b5 and AT3G23325

Sequence 1:NP_652189.1 Gene:Sf3b5 FlyBaseID:FBgn0040534 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_566727.1 Gene:AT3G23325 AraportID:AT3G23325 Length:87 Species:Arabidopsis thaliana

Alignment Length:83 Identity:55/84 (65%)
Similarity:69/84 (82%) Gaps:1/84 (1%)


  Fly     3 ERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDILNYFAIAENESKARVRFN 67
            :|:||:|||||||:||:||||||.::|||..|..|||.|||:|||.:|:|||||||||..|.|:|
plant     5 DRFNINSQLEHLQAKYVGTGHADLSRFEWTVNIQRDSYASYIGHYPMLSYFAIAENESIGRERYN 69

  Fly    68 LMERMLQPCGPPPEKLED 85
            .|::||.|||.|||: ||
plant    70 FMQKMLLPCGLPPER-ED 86

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sf3b5NP_652189.1 SF3b10 3..77 CDD:311252 49/74 (66%)
AT3G23325NP_566727.1 SF3b10 5..79 CDD:284578 49/74 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H41825
Inparanoid 1 1.050 123 1.000 Inparanoid score I1902
OMA 1 1.010
OrthoDB 1 1.010 D1632322at2759
OrthoInspector 1 1.000 T124637
orthoMCL 1 0.900 OOG5_128788
Panther 1 1.100 LDO PTHR20978
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.