DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sf3b5 and Sf3b5

Sequence 1:NP_652189.1 Gene:Sf3b5 FlyBaseID:FBgn0040534 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_780311.2 Gene:Sf3b5 MGIID:1913375 Length:86 Species:Mus musculus

Alignment Length:85 Identity:70/86 (81%)
Similarity:77/86 (90%) Gaps:0/86 (0%)


  Fly     1 MGERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDILNYFAIAENESKARVR 65
            |.:||.||||||||||||||||||||||:|||.||||||..|||||:|:||||||||||||||||
Mouse     1 MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVR 65

  Fly    66 FNLMERMLQPCGPPPEKLED 85
            |||||:||||.|||.:|.|:
Mouse    66 FNLMEKMLQPSGPPADKPEE 85

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sf3b5NP_652189.1 SF3b10 3..77 CDD:311252 64/74 (86%)
Sf3b5NP_780311.2 SF3b10 3..77 CDD:336629 64/74 (86%)
Interaction with SF3B1 and SF3B3. {ECO:0000250|UniProtKB:Q9BWJ5} 15..76 54/61 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C215036097
eggNOG 1 0.900 E1_KOG3485
Hieranoid 1 1.000
Homologene 1 1.000 H41825
Inparanoid 1 1.050 153 1.000 Inparanoid score I4299
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004044
OrthoInspector 1 1.000 T1084237
orthoMCL 1 0.900 OOG5_128788
Panther 1 1.100 LDO PTHR20978
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1873
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.