DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sf3b5 and sf3b5

Sequence 1:NP_652189.1 Gene:Sf3b5 FlyBaseID:FBgn0040534 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001016441.1 Gene:sf3b5 XenbaseID:XB-GENE-5845857 Length:86 Species:Xenopus tropicalis

Alignment Length:85 Identity:70/86 (81%)
Similarity:78/86 (91%) Gaps:0/86 (0%)


  Fly     1 MGERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDILNYFAIAENESKARVR 65
            |.:||.||||||||||||||||||||||:|||.||||||..|||||:|:|||||:||||||||||
 Frog     1 MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAVAENESKARVR 65

  Fly    66 FNLMERMLQPCGPPPEKLED 85
            |||||:||||||||.:|.:|
 Frog    66 FNLMEKMLQPCGPPADKPDD 85

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sf3b5NP_652189.1 SF3b10 3..77 CDD:311252 64/74 (86%)
sf3b5NP_001016441.1 SF3b10 3..77 CDD:311252 64/74 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C215037030
eggNOG 1 0.900 E1_KOG3485
Hieranoid 1 1.000
Homologene 1 1.000 H41825
Inparanoid 1 1.050 157 1.000 Inparanoid score I4070
OMA 1 1.010
OrthoDB 1 1.010 D1632322at2759
OrthoFinder 1 1.000 FOG0004044
OrthoInspector 1 1.000 T1060214
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1873
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.