DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and AT1G20270

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana

Alignment Length:238 Identity:64/239 (27%)
Similarity:107/239 (45%) Gaps:50/239 (21%)


  Fly   279 NTTTTP-----FTRIAPLKMEELG-----------LDPYMVVFHDVIYDTEIDGMLN-------S 320
            |..::|     |.|.|..:.|.||           .:|...|:|:.:...|.:.:::       .
plant    46 NDESSPIDLSYFRRAATERSEGLGKRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVK 110

  Fly   321 SNFGLSLTDSGQKSEVRTSKDSYIVDA-----KTLNERVTDMTGFSMEMSDPFSLINYGLGGHYM 380
            |....|.|...:.|.||||..:::...     ||:.:|:.|.|....:..:...:::|..|..|.
plant   111 STVVDSETGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYE 175

  Fly   381 LHYD-FHEYTNTTRPKQGDRIATVLFYLGEVDSGGATIFPMIN-------------------ITV 425
            .||| |.:..||  ...|.|:||:|.||.:|:.||.|:||..|                   ::|
plant   176 PHYDYFVDEFNT--KNGGQRMATMLMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSV 238

  Fly   426 TPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWIN 468
            .|:.|.|:.::::.....::..|||..||||.|:|:..|||::
plant   239 KPRMGDALLFWSMRPDATLDPTSLHGGCPVIRGNKWSSTKWMH 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 10/43 (23%)
P4Hc 313..467 CDD:214780 53/186 (28%)
AT1G20270NP_564109.1 DUF4713 <3..38 CDD:292459
P4Hc 93..281 CDD:214780 53/190 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32325
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.