DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and AT5G18900

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_197391.1 Gene:AT5G18900 AraportID:AT5G18900 Length:298 Species:Arabidopsis thaliana

Alignment Length:225 Identity:68/226 (30%)
Similarity:104/226 (46%) Gaps:37/226 (16%)


  Fly   288 IAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGLSLT-----DSGQK--SEVRTSKDSYIV 345
            :.|.|::::...|...|:...:.:.|.|.|::.:...|..:     |||:.  ||||||..::|.
plant    32 VNPSKVKQVSSKPRAFVYEGFLTELECDHMVSLAKASLKRSAVADNDSGESKFSEVRTSSGTFIS 96

  Fly   346 DAKT-----LNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYD-FHEYTNTTRPKQGDRIATVL 404
            ..|.     :.::::..|....|..:...::.|..|..|..|:| ||:..|..|  .|.|:||:|
plant    97 KGKDPIVSGIEDKISTWTFLPKENGEDIQVLRYEHGQKYDAHFDYFHDKVNIVR--GGHRMATIL 159

  Fly   405 FYLGEVDSGGATIFP---------------------MINITVTPKKGSAVFWYNLHNSGAMNLKS 448
            .||..|..||.|:||                     ...|.|.|:||.|:.::|||.....:..|
plant   160 MYLSNVTKGGETVFPDAEIPSRRVLSENKEDLSDCAKRGIAVKPRKGDALLFFNLHPDAIPDPLS 224

  Fly   449 LHSACPVISGSKYVLTKWIN-ELPQMFVTP 477
            ||..||||.|.|:..||||: :.....|||
plant   225 LHGGCPVIEGEKWSATKWIHVDSFDRIVTP 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 4/18 (22%)
P4Hc 313..467 CDD:214780 60/188 (32%)
AT5G18900NP_197391.1 P4Hc 54..244 CDD:214780 61/192 (32%)
ShKT 258..298 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32325
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.