DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and AT4G35810

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana

Alignment Length:210 Identity:58/211 (27%)
Similarity:99/211 (47%) Gaps:38/211 (18%)


  Fly   293 MEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGLS-------LTDSGQKSEVRTSKDSY------- 343
            :|.:..:|...|:|:.:.:.|.:.:::.:...:.       .|.....|.||||..::       
plant    80 LEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVKTGKSIDSRVRTSSGTFLNRGHDE 144

  Fly   344 IVDAKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYD-FHEYTNTTRPKQGDRIATVLFYL 407
            ||:  .:..|::|.|....|..:...:::|.:|..|..|:| |.:..|..  |.|.||||||.||
plant   145 IVE--EIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHDYFFDEFNVR--KGGQRIATVLMYL 205

  Fly   408 GEVDSGGATIFPMI-------------------NITVTPKKGSAVFWYNLHNSGAMNLKSLHSAC 453
            .:||.||.|:||..                   .::|.|||..|:.::::....:::..|||..|
plant   206 SDVDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDPSSLHGGC 270

  Fly   454 PVISGSKYVLTKWIN 468
            |||.|:|:..|||.:
plant   271 PVIKGNKWSSTKWFH 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 3/13 (23%)
P4Hc 313..467 CDD:214780 54/188 (29%)
AT4G35810NP_001320148.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32325
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.