DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and AT4G33910

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_567941.1 Gene:AT4G33910 AraportID:AT4G33910 Length:288 Species:Arabidopsis thaliana

Alignment Length:273 Identity:66/274 (24%)
Similarity:99/274 (36%) Gaps:92/274 (34%)


  Fly   242 PEGIIASNEV--------------IHFKEELSTKQNCAVVVQ------KPSRLHCRYNTT--TTP 284
            |.|:.....:              |:| ...:|.:.|..:::      |||.|..|...|  .|.
plant    64 PHGVTGEESIGSIPFQVLSWRPRAIYF-PNFATAEQCQAIIERAKVNLKPSALALRKGETAENTK 127

  Fly   285 FTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGLSLTDSG---QKSEVRTSKDSYIVD 346
            .||                                        |.||   ..||..|....::  
plant   128 GTR----------------------------------------TSSGTFISASEESTGALDFV-- 150

  Fly   347 AKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTR--PKQGDRIATVLFYLGE 409
                ..::...|.......:.|:::.|.||..|..|||..   |.|.  |:...|||:.|.||.:
plant   151 ----ERKIARATMIPRSHGESFNILRYELGQKYDSHYDVF---NPTEYGPQSSQRIASFLLYLSD 208

  Fly   410 VDSGGATIFPM---------------INITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGS 459
            |:.||.|:||.               |.:.|.|:||..:.:|::..:|.::..|||.:|||..|.
plant   209 VEEGGETMFPFENGSNMGIGYDYKQCIGLKVKPRKGDGLLFYSVFPNGTIDQTSLHGSCPVTKGE 273

  Fly   460 KYVLTKWINELPQ 472
            |:|.||||.:..|
plant   274 KWVATKWIRDQDQ 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 15/86 (17%)
P4Hc 313..467 CDD:214780 49/174 (28%)
AT4G33910NP_567941.1 P4Hc 95..282 CDD:214780 61/236 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32325
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.