DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and P4H2

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:221 Identity:68/221 - (30%)
Similarity:103/221 - (46%) Gaps:36/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 TTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGML-----NSSNFGLSLTDSG--QKSEVRTS 339
            ::|.:.|.|.|::::...|...|:...:.|.|.|.::     |.....::..|:|  |.|:||||
plant    27 SSPSSIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRSAVADNDNGESQVSDVRTS 91

  Fly   340 KDSYIVDAKT-----LNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYD-FHEYTNTTRPKQGD 398
            ..::|...|.     :.::::..|....|..:...::.|..|..|..|:| ||:..|..|  .|.
plant    92 SGTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHDKVNIAR--GGH 154

  Fly   399 RIATVLFYLGEVDSGGATIFP---------------------MINITVTPKKGSAVFWYNLHNSG 442
            ||||||.||..|..||.|:||                     ...|.|.||||:|:.::||....
plant   155 RIATVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLSDCAKKGIAVKPKKGNALLFFNLQQDA 219

  Fly   443 AMNLKSLHSACPVISGSKYVLTKWIN 468
            ..:..|||..||||.|.|:..||||:
plant   220 IPDPFSLHGGCPVIEGEKWSATKWIH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 6/23 (26%)
P4Hc 313..467 CDD:214780 59/187 (32%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 61/191 (32%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.