DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and P4H2

DIOPT Version :10

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:221 Identity:68/221 - (30%)
Similarity:103/221 - (46%) Gaps:36/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 TTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGML-----NSSNFGLSLTDSG--QKSEVRTS 339
            ::|.:.|.|.|::::...|...|:...:.|.|.|.::     |.....::..|:|  |.|:||||
plant    27 SSPSSIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRSAVADNDNGESQVSDVRTS 91

  Fly   340 KDSYIVDAKT-----LNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYD-FHEYTNTTRPKQGD 398
            ..::|...|.     :.::::..|....|..:...::.|..|..|..|:| ||:..|..|  .|.
plant    92 SGTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHDKVNIAR--GGH 154

  Fly   399 RIATVLFYLGEVDSGGATIFP---------------------MINITVTPKKGSAVFWYNLHNSG 442
            ||||||.||..|..||.|:||                     ...|.|.||||:|:.::||....
plant   155 RIATVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLSDCAKKGIAVKPKKGNALLFFNLQQDA 219

  Fly   443 AMNLKSLHSACPVISGSKYVLTKWIN 468
            ..:..|||..||||.|.|:..||||:
plant   220 IPDPFSLHGGCPVIEGEKWSATKWIH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..168 CDD:462433
P4Hc 313..467 CDD:214780 59/187 (32%)
P4H2NP_566279.1 PLN00052 37..299 CDD:177683 65/211 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.