DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and AT-P4H-1

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:219 Identity:59/219 - (26%)
Similarity:97/219 - (44%) Gaps:30/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 NTTTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGM-------LNSSNFGLSLTDSGQKSEV 336
            |.......||..:|.|.:...|.::|.||.:...|.:.:       |..|......|..|.||:|
plant    63 NDKDAELLRIGNVKPEVVSWSPRIIVLHDFLSPEECEYLKAIARPRLQVSTVVDVKTGKGVKSDV 127

  Fly   337 RTSKDSYIVDA-------KTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRP 394
            |||...::...       :.:.:|:...:....|..:...::.|.....|..|:|:  :.:|...
plant   128 RTSSGMFLTHVERSYPIIQAIEKRIAVFSQVPAENGELIQVLRYEPQQFYKPHHDY--FADTFNL 190

  Fly   395 KQ-GDRIATVLFYLGEVDSGGATIFP-------------MINITVTPKKGSAVFWYNLHNSGAMN 445
            |: |.|:||:|.||.:...||.|.||             |..|:|.|.||.||.::::...|..:
plant   191 KRGGQRVATMLMYLTDDVEGGETYFPLAGDGDCTCGGKIMKGISVKPTKGDAVLFWSMGLDGQSD 255

  Fly   446 LKSLHSACPVISGSKYVLTKWINE 469
            .:|:|..|.|:||.|:..|||:.:
plant   256 PRSIHGGCEVLSGEKWSATKWMRQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 7/26 (27%)
P4Hc 313..467 CDD:214780 49/181 (27%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 54/202 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.