DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and AT-P4H-1

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana

Alignment Length:219 Identity:59/220 (27%)
Similarity:97/220 (44%) Gaps:30/220 (14%)


  Fly   279 NTTTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGM-------LNSSNFGLSLTDSGQKSEV 336
            |.......||..:|.|.:...|.::|.||.:...|.:.:       |..|......|..|.||:|
plant    63 NDKDAELLRIGNVKPEVVSWSPRIIVLHDFLSPEECEYLKAIARPRLQVSTVVDVKTGKGVKSDV 127

  Fly   337 RTSKDSYIVDA-------KTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRP 394
            |||...::...       :.:.:|:...:....|..:...::.|.....|..|:|:  :.:|...
plant   128 RTSSGMFLTHVERSYPIIQAIEKRIAVFSQVPAENGELIQVLRYEPQQFYKPHHDY--FADTFNL 190

  Fly   395 KQ-GDRIATVLFYLGEVDSGGATIFP-------------MINITVTPKKGSAVFWYNLHNSGAMN 445
            |: |.|:||:|.||.:...||.|.||             |..|:|.|.||.||.::::...|..:
plant   191 KRGGQRVATMLMYLTDDVEGGETYFPLAGDGDCTCGGKIMKGISVKPTKGDAVLFWSMGLDGQSD 255

  Fly   446 LKSLHSACPVISGSKYVLTKWINE 469
            .:|:|..|.|:||.|:..|||:.:
plant   256 PRSIHGGCEVLSGEKWSATKWMRQ 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 7/27 (26%)
P4Hc 313..467 CDD:214780 50/182 (27%)
AT-P4H-1NP_181836.1 P4Hc 94..278 CDD:214780 50/186 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32325
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.