DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and P4H13

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:265 Identity:71/265 - (26%)
Similarity:105/265 - (39%) Gaps:75/265 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 TDAFYH---FENKPEGIIASNEVIHFKEELSTKQNCAVVVQ------KPSRLHCRYNTTTTPFTR 287
            ||:..|   ..|.|...::.|..:.:....:|||.|..|:.      |||.|..|...|.     
plant    54 TDSLDHGSSVSNIPFHGLSWNPRVFYLPNFATKQQCEAVIDMAKPKLKPSTLALRKGETA----- 113

  Fly   288 IAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGLSLTDSGQKSEVRTSKDSYIVDAKTLNE 352
                                                  ..|.:.:.....|.:|...|.| .:.|
plant   114 --------------------------------------ETTQNYRSLHQHTDEDESGVLA-AIEE 139

  Fly   353 RVTDMTGFSMEMSDPFSLINYGLGGHYMLHYD-FH--EYTNTTRPKQGDRIATVLFYLGEVDSGG 414
            ::...|.|..:..:.|:::.|.||..|..||| ||  ||    .|....|:.|.|.:|..|:.||
plant   140 KIALATRFPKDYYESFNILRYQLGQKYDSHYDAFHSAEY----GPLISQRVVTFLLFLSSVEEGG 200

  Fly   415 ATIFPM---------------INITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLT 464
            .|:||.               :.:.|.|::|.|:|:|||..:|.::..|||.:||||.|.|:|.|
plant   201 ETMFPFENGRNMNGRYDYEKCVGLKVKPRQGDAIFFYNLFPNGTIDQTSLHGSCPVIKGEKWVAT 265

  Fly   465 KWINE 469
            |||.:
plant   266 KWIRD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 15/77 (19%)
P4Hc 313..467 CDD:214780 52/171 (30%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 64/231 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.