DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and p4htm

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_001340234.2 Gene:p4htm ZFINID:ZDB-GENE-110131-7 Length:510 Species:Danio rerio

Alignment Length:396 Identity:103/397 (26%)
Similarity:143/397 (36%) Gaps:164/397 (41%)


  Fly   218 HKAWGLLLAKNKQLT-DAFY---HFENKPEGI---------IASNEVIHFKEELSTK-------- 261
            ||..|   |.:.|.| |:.:   .|..:.|||         :.|.:| |..:.||.|        
Zfish   102 HKVTG---ASDAQATADSGFPRNMFLPRIEGIRVGHVQKVSLVSGKV-HEMKTLSLKPLLFEIPD 162

  Fly   262 ----QNCAVVVQKPSRLHCRYNTTTTPFTRIAPLK------------MEELG------------- 297
                :.|||||                  |:|.||            .|||.             
Zfish   163 FLSEEECAVVV------------------RLAQLKGLMESQVMVPEGQEELDQQLNLSPEEIFNF 209

  Fly   298 --------LDPYMVVFHD--------------VIYD---TEID--GMLNSSNFGLSLTDSGQK-- 333
                    |.|:.::.|.              .|||   .::|  |:|:...||...:|:.|:  
Zfish   210 LDLNQDGQLQPHEILTHSRVRDGIWLTSENLKEIYDGLKADLDGNGLLSLEEFGRLRSDAFQRFL 274

  Fly   334 --------SEVRTSKDSYIVDA-------KTLNERVTDMTGFS---MEMSDPFSLINYGLGGHYM 380
                    ..||.|:.:::...       :.|.:|||.:|...   :|:|:|..::.|..||||.
Zfish   275 LQRGVERSQLVRNSRHTWLYQGQGAHQVLQDLRKRVTLLTRLPSSLVELSEPLQVVRYEQGGHYH 339

  Fly   381 LHYD----FHE--------YTNTTRPKQGD-RIATVLFYLGEVDSGGATIFPMI----------- 421
            .|:|    :.|        ..|||.|.|.. |..||||||..|..||.|.||:.           
Zfish   340 AHHDSGPVYPETACTHTRLAANTTSPFQTSCRYITVLFYLNNVQEGGETTFPVADNRTYEEASLI 404

  Fly   422 ----------------NITVTPKKGSAVFWYNLHNS-----GAMNLKSLHSACPVISGSKYVLTK 465
                            |:.|.|.||:||||||..:.     |..:..|||..|.|..|:|:|...
Zfish   405 QNDVDLLDTRKHCDKGNLRVKPVKGTAVFWYNYLSDGRGWVGEQDEYSLHGGCVVTQGTKWVANN 469

  Fly   466 WINELP 471
            |||..|
Zfish   470 WINVDP 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 24/123 (20%)
P4Hc 313..467 CDD:214780 65/221 (29%)
p4htmXP_001340234.2 EF-hand_7 204..262 CDD:290234 9/58 (16%)
EFh 204..262 CDD:298682 9/58 (16%)
P4Hc 285..471 CDD:214780 58/186 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92048437
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.