| Sequence 1: | NP_652183.2 | Gene: | CG15864 / 50001 | FlyBaseID: | FBgn0040528 | Length: | 490 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_083220.3 | Gene: | P4htm / 74443 | MGIID: | 1921693 | Length: | 503 | Species: | Mus musculus |
| Alignment Length: | 226 | Identity: | 65/226 - (28%) |
|---|---|---|---|
| Similarity: | 95/226 - (42%) | Gaps: | 65/226 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 311 DTEIDGMLNSSNF-GLSLTD-----SGQKSE----VRTSKDSYIVDA-------KTLNERVTDMT 358
Fly 359 GFS---MEMSDPFSLINYGLGGHYMLHYD----FHE--------YTNTTRP-KQGDRIATVLFYL 407
Fly 408 GEVDSGGATIFPMI---------------------------NITVTPKKGSAVFWYNLHNS---- 441
Fly 442 -GAMNLKSLHSACPVISGSKYVLTKWINELP 471 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15864 | NP_652183.2 | P4Ha_N | 35..166 | CDD:285528 | |
| metallo-dependent_hydrolases | <237..>306 | CDD:294200 | |||
| P4Hc | 313..467 | CDD:214780 | 60/218 (28%) | ||
| P4htm | NP_083220.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..49 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 90..110 | ||||
| EF-hand_7 | 193..253 | CDD:290234 | 5/14 (36%) | ||
| EFh | 195..253 | CDD:298682 | 5/14 (36%) | ||
| P4Hc | 247..459 | CDD:214780 | 57/211 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167839371 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1591 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.740 | |||||