DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and P4htm

DIOPT Version :10

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_083220.3 Gene:P4htm / 74443 MGIID:1921693 Length:503 Species:Mus musculus


Alignment Length:226 Identity:65/226 - (28%)
Similarity:95/226 - (42%) Gaps:65/226 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 DTEIDGMLNSSNF-GLSLTD-----SGQKSE----VRTSKDSYIVDA-------KTLNERVTDMT 358
            |.:.||:|:...| .:.|.|     ...|:|    ||.|..:::...       :.:.:||..:|
Mouse   238 DPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESNELVRNSHHTWLHQGEGAHHVMRAIRQRVLRLT 302

  Fly   359 GFS---MEMSDPFSLINYGLGGHYMLHYD----FHE--------YTNTTRP-KQGDRIATVLFYL 407
            ..|   :|.|:|..::.||.||||..|.|    :.|        ..|.:.| :...|..||||||
Mouse   303 RLSPEIVEFSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYL 367

  Fly   408 GEVDSGGATIFPMI---------------------------NITVTPKKGSAVFWYNLHNS---- 441
            ..|..||.|:||:.                           |:.|.|::|:||||||....    
Mouse   368 NNVTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGW 432

  Fly   442 -GAMNLKSLHSACPVISGSKYVLTKWINELP 471
             |.::..|||..|.|..|:|::...|||..|
Mouse   433 VGEVDDYSLHGGCLVTRGTKWIANNWINVDP 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..168 CDD:462433
P4Hc 313..467 CDD:214780 60/218 (28%)
P4htmNP_083220.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..110
EF-hand_7 193..253 CDD:463900 5/14 (36%)
P4Hc 247..459 CDD:214780 57/211 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.