DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and P4ha1

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_742059.2 Gene:P4ha1 RGDID:621000 Length:534 Species:Rattus norvegicus

Alignment Length:518 Identity:146/519 (28%)
Similarity:245/519 (47%) Gaps:81/519 (16%)


  Fly    32 YAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPLNSF 96
            :..|..::..|:..|.:||.:||.|:|..:.|...:::....:.|.......|.|.::|:|:|:|
  Rat    21 FFTSIGQMTDLIHNEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAF 85

  Fly    97 RLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKMLPTSSDLQQACRGIHDLMSFYDLKPEEL 161
            :|:.||:|.|.:.....:|..::  |.|.|..:.|:..|...|...|.:.:..|...|:|....:
  Rat    86 KLMKRLNTEWSELENLILKDMSD--GFISNLTIQRQYFPNDEDQVGAAKALFRLQDTYNLDTNTI 148

  Fly   162 AAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDLAEAWYNLSLIRFE----NKFDK-------- 214
            :.|||.|.... :.|||.||..||:.:..:.:....|.|...:|::.|    :..||        
  Rat   149 SKGNLPGVKHK-SFLTAEDCFELGKVAYTEADYYHTELWMEQALMQLEEGEMSTVDKVSVLDYLS 212

  Fly   215 YRVHKAWGL---LLAKNKQLTDAFYHFENKPEGIIASNEVIHFK------------------EEL 258
            |.|::...|   ||...|.|       |..||...|:..:::|:                  ::.
  Rat   213 YAVYQQGDLDKALLLTKKLL-------ELDPEHQRANGNLVYFEYIMSKEKDANKSASGDQSDQK 270

  Fly   259 STKQNCAVVV----------------------QKPSRLHCRYNT-TTTPFTRIAPLKMEELGLDP 300
            :|.:...:.|                      ::..||.|||:. ...|...:||.|.|:....|
  Rat   271 TTPKKKGIAVDYLPERQKYEMLCRGEGIKMTPRRQKRLFCRYHDGNRNPKFILAPAKQEDEWDKP 335

  Fly   301 YMVVFHDVIYDTEIDGMLNSSNFGLSLT-----DSGQ--KSEVRTSKDSYIVD-----AKTLNER 353
            .::.|||:|.|.||:.:.:.:...||..     ::|:  .::.|.||.:::..     ...:|.|
  Rat   336 RIIRFHDIISDAEIEIVKDLAKPRLSRATVHDPETGKLTTAQYRVSKSAWLSGYEDPVVSRINMR 400

  Fly   354 VTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQ---GDRIATVLFYLGEVDSGGA 415
            :.|:||..:..::...:.|||:||.|..|:||.........::   |:||||.|||:.:|.:|||
  Rat   401 IQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFRELGTGNRIATWLFYMSDVSAGGA 465

  Fly   416 TIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWINELPQMFVTPC 478
            |:||.:..:|.||||:|||||||..||..:..:.|:||||:.|:|:|..||::|..|.|..||
  Rat   466 TVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPC 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 35/131 (27%)
metallo-dependent_hydrolases <237..>306 CDD:294200 19/110 (17%)
P4Hc 313..467 CDD:214780 61/169 (36%)
P4ha1NP_742059.2 P4Ha_N 24..153 CDD:285528 35/131 (27%)
TPR 205..238 10/40 (25%)
P4Hc 345..518 CDD:214780 62/173 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.