DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and p4ha3

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_021322008.1 Gene:p4ha3 ZFINID:ZDB-GENE-041010-4 Length:616 Species:Danio rerio

Alignment Length:543 Identity:141/544 (26%)
Similarity:249/544 (46%) Gaps:96/544 (18%)


  Fly    23 FVKSNPKKSYA---ASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSD 84
            ::.:.|.:|:.   .|.:.:.:.:..|.:|:|:|..|::....:...::|....::..:..:.::
Zfish    12 YLLNMPDESFGEMFTSMLSVNQAVSAERKLIDHLIIYIEHEAQRLEDIKRFFSRVTSLHDGIYNE 76

  Fly    85 YESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKMLPTSSDLQQACRGIHD 149
            ....:.||:.:|:|:.||.:.|.. ..::.:.|.|.....|:.|.|...||...||:.|..|:..
Zfish    77 PSDPIANPIAAFKLVKRLKSEWLN-VVHSTEAEENIKVLREDYRRMESSLPKLEDLRGAAHGLMR 140

  Fly   150 LMSFYDLKPEELAAGNLAGYSQP--------GTGLTAYDCLALGEFSVQKREDDLAEAWYNLSLI 206
            |...|:|..|.|..|:....|.|        ...|:..||..:|:.:.     || |.:|: |::
Zfish   141 LQDVYNLHVESLVRGHFQQISDPVDFYKLSVSDMLSGDDCFLVGKVAY-----DL-EDYYH-SVL 198

  Fly   207 RFENKFDKYRVHKAWGLLLAKNK-QLTD-----AFYHFE--NKPEGIIASNEV---------IHF 254
            .||.....:| ...|.   .:|: .|.|     ||.||:  |....:..|.|:         :||
Zfish   199 WFEEAVRLFR-GTEWS---PENEGTLEDALDHLAFSHFKTGNISHALSLSRELLLHDPMNRRVHF 259

  Fly   255 KEE--------------------------LSTK----QNCAVVVQKPSR-----LHCRYNTTTTP 284
            ..|                          |.|:    |.|.....:|..     |.|.|.|..:|
Zfish   260 NVEKYEKLLNENLPATSSGLTLKRPDGIYLRTRNAYEQLCQTKGSQPKHFENPSLFCDYFTNGSP 324

  Fly   285 FTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGL--SLTDSGQK---SEVRTSKDSYI 344
            ...:.|::.|.:.|.||:|:||..:...|...:...:..||  |:..||..   :|.|.||.:::
Zfish   325 ALFLQPIRREIISLQPYVVLFHGFVTQAEAKNIRKYAMPGLRRSVVASGMNQATAEYRISKSAWL 389

  Fly   345 VDAK-----TLNERVTDMTGFSME--MSDPFSLINYGLGGHYMLHYDFHEYTNTT---RPKQGDR 399
            .::.     .|::|:|.:||.:::  .::...::|||:||||..|:| |..::::   |.|.|:|
Zfish   390 KESAHEVVGKLDQRITLVTGLNVQPPYAEYLQVVNYGIGGHYEPHFD-HATSDSSPLYRLKTGNR 453

  Fly   400 IATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLT 464
            :||::.||..|.:||:|.|...|.:|...:.:|:||:|||.:|..|:.:||:.||||.|:|:.:.
Zfish   454 VATIMIYLSPVQAGGSTAFIYANFSVPVVQNAALFWWNLHKNGQGNVDTLHAGCPVIVGNKWGMF 518

  Fly   465 KWINELPQMFVTPCMKDSNL-HP 486
            |..|    .....|...:|: ||
Zfish   519 KNKN----FHKVTCTAVTNIVHP 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 31/131 (24%)
metallo-dependent_hydrolases <237..>306 CDD:294200 25/115 (22%)
P4Hc 313..467 CDD:214780 57/169 (34%)
p4ha3XP_021322008.1 P4Ha_N 27..157 CDD:311993 31/131 (24%)
P4Hc 350..519 CDD:214780 56/170 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92138452
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.