DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and p4ha1a

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_009304776.1 Gene:p4ha1a ZFINID:ZDB-GENE-040724-91 Length:541 Species:Danio rerio

Alignment Length:552 Identity:153/553 (28%)
Similarity:255/553 (46%) Gaps:88/553 (16%)


  Fly     9 LIGFLSACFINCQGFVKSNPKKS-YAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLI 72
            ::|..|.|.......:||:...| :..|...:..||..|.:||.:||.|:|..:.|...:::...
Zfish     1 MMGVRSVCCFLLISLLKSSSAHSDFFTSIGHMTDLLFTEKDLVTSLKDYIKAEESKLEQVKQWAE 65

  Fly    73 DMSRENMEMKSDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKMLPTS 137
            .:.........|.|.:||:|:|:|:|:.||:|.|.:.....:|..::  |.|.|..:.|:..|..
Zfish    66 KLDALTATAVQDPEGFLGHPVNAFKLMKRLNTEWGEVEDLVLKDMSD--GFISNLTIQRQYFPND 128

  Fly   138 SDLQQACRGIHDLMSFYDLKPEELAAGNLAGYSQPGTG------LTAYDCLALGEFSVQKREDDL 196
            .|...|.:.:..|...|.|..:.:::|:|.|.:   ||      ||..||..||:.:....:...
Zfish   129 EDQNGAAKALLRLQDTYKLDTQTISSGDLPGVN---TGLPYKSTLTVEDCFELGKIAYSDADYYH 190

  Fly   197 AEAWYNLSLIRFEN------------KFDKYRVH-----------------------KAWGLL-- 224
            .|.|...:|.:.:.            .:..|.|:                       :|.|.|  
Zfish   191 TELWMAQALKQLDEGEESSVEIATALDYLSYSVYQQGELERALEYTKRLLTVEPEHQRALGNLKY 255

  Fly   225 ----LAKNK-----QLTDAFYHFENKPEGIIASNEVIHFKEELSTKQNC-----AVVVQKPSRLH 275
                |||.|     |.|..    |:|.|...:..:..:..|:...::.|     .:..::...|.
Zfish   256 FDYQLAKQKKAEKEQSTKE----ESKKEQETSDGKKEYLPEKRKYEKLCRGEGLKMTPRRQKHLF 316

  Fly   276 CRY-NTTTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGM-------LNSSNFGLSLTDSGQ 332
            ||| |....||..|.|:|.|:....|.::.:|::|.:.||:.:       |..:.....:|...:
Zfish   317 CRYFNGNRHPFYTIGPVKQEDEWDRPRIIRYHEIITEQEIEKIKELSKPRLRRATISNPITGVLE 381

  Fly   333 KSEVRTSKDSY-------IVDAKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTN 390
            .:..|.||.::       :||  .:|:|:.|:||.:::.::...:.|||:||.|..|:||.....
Zfish   382 TAHYRISKSAWLAAYEHPVVD--RINQRIEDITGLNVKTAEELQVANYGVGGQYEPHFDFGRKDE 444

  Fly   391 TTRPKQ---GDRIATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSA 452
            ....|:   |:||||.|||:.:|.:||||:||.:...|.|.||:|||||||..||..:..:.|:|
Zfish   445 PDAFKELGTGNRIATWLFYMSDVAAGGATVFPEVGAAVKPLKGTAVFWYNLFPSGEGDYSTRHAA 509

  Fly   453 CPVISGSKYVLTKWINELPQMFVTPC-MKDSN 483
            |||:.|:|:|..|||:|..|.|..|| :|:::
Zfish   510 CPVLVGNKWVSNKWIHERGQEFRRPCGLKETD 541

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 35/131 (27%)
metallo-dependent_hydrolases <237..>306 CDD:294200 17/75 (23%)
P4Hc 313..467 CDD:214780 62/171 (36%)
p4ha1aXP_009304776.1 P4Ha_N 28..157 CDD:285528 35/131 (27%)
TPR repeat 172..207 CDD:276809 7/35 (20%)
TPR repeat 212..242 CDD:276809 2/30 (7%)
Fis1 218..262 CDD:304536 7/44 (16%)
P4Hc 352..525 CDD:214780 63/175 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92008825
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.