DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and zgc:152670

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001070123.2 Gene:zgc:152670 ZFINID:ZDB-GENE-060929-954 Length:490 Species:Danio rerio

Alignment Length:533 Identity:153/534 (29%)
Similarity:246/534 (46%) Gaps:109/534 (20%)


  Fly     4 LKNLTLIGFLSACFINCQGFVKSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLME 68
            :|.|||       |:.|..|| |..::.:.:|..::.:|...|:.|:|....|:...:.....|:
Zfish     3 MKELTL-------FVVCSWFV-SITEQEFFSSVDQVSQLFNEEENLLDTFSLYIDAEEENLKKMK 59

  Fly    69 RSLIDMSRENMEMKSDYESYLGNPLNSFRLIHRLHTSW---RKWYQYAIKVENNALGHIENARLM 130
            ..|:.:...:.......|..:.:|:.:|:|:.||...|   .|:.|.::..|...|       |.
Zfish    60 SLLLLLQLGSFSNPQSPEETMRDPVAAFKLLKRLRHEWVNIAKFTQQSLYQEFQTL-------LD 117

  Fly   131 RKMLPTSSDLQQACRGIHDLMSFYDLKPEELA-----AGNLAGYSQPGTGLTAYDCLALGEFSVQ 190
            ..::|...|:..|..|:..|...|.|.|..:.     :.:.|.|    .||.||:          
Zfish   118 YSLIPELEDINSAALGLIGLQEIYKLYPHNITKETPLSADEAYY----IGLVAYE---------- 168

  Fly   191 KREDDLAEA--WYNLSLIRFEN-----KFDKYRVHKAWGLLLAKNKQLTDAFYHFENKPEGIIAS 248
              ||....|  |:..||.|..:     |.|..|.             |:.:.|.|.:.|..|...
Zfish   169 --EDKFQHAFLWFLHSLNRLTDFSSTTKNDLLRF-------------LSSSAYQFGSLPVAIYFG 218

  Fly   249 NEVIHF---KEE-----------------------LSTKQN------C-AVVVQKPSR----LHC 276
            .::::.   .||                       |:|:.|      | ..|.::.|:    |.|
Zfish   219 QKLLNLDPSNEEIKVQLGLYRLIRLQRTSNPDIFTLNTQSNNSYEALCRGEVDERTSKRQRALSC 283

  Fly   277 RYNT-TTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGL--SLTDSGQKSEVRT 338
            ||:| ...|....||:|.|||..:|.::.:||||.||||:.:.:.:...|  |.|..|..|::||
Zfish   284 RYSTGGGNPRLMYAPVKEEELWDEPKIIRYHDVISDTEIETLKDIARPELTRSQTGWGVISDIRT 348

  Fly   339 SKDSYIVDAKT---LNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQGDRI 400
            |:..::.:..|   :::|:.|:||.|:|.::...:.|||:||.|..|:|..:..|       :|.
Zfish   349 SQSVFLEEVGTVARISQRIADITGLSVESAEKLHVQNYGIGGRYTPHFDTGDEVN-------ERT 406

  Fly   401 ATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTK 465
            ||.|.|:.:|:.||||:|..:.:.|.|:|||||||||||.:|.::||:.|:.|||:.|:|:|..|
Zfish   407 ATFLIYMSDVEVGGATVFTNVGVAVKPEKGSAVFWYNLHKNGELDLKTKHAGCPVLVGNKWVANK 471

  Fly   466 WINELPQMFVTPC 478
            ||:|..|.|..||
Zfish   472 WIHEFGQEFRRPC 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 28/139 (20%)
metallo-dependent_hydrolases <237..>306 CDD:294200 24/107 (22%)
P4Hc 313..467 CDD:214780 62/159 (39%)
zgc:152670NP_001070123.2 P4Ha_N 26..150 CDD:285528 28/131 (21%)
P4Hc 318..474 CDD:214780 65/163 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.