DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and p4ha2

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_017947536.1 Gene:p4ha2 XenbaseID:XB-GENE-957618 Length:557 Species:Xenopus tropicalis

Alignment Length:546 Identity:139/547 (25%)
Similarity:239/547 (44%) Gaps:122/547 (22%)


  Fly    35 STMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPLNSFRLI 99
            ||.::..|:..|.:|:.:||.|::..:.:.:.::|...::...:....:|.|.|||:|:|:::|:
 Frog    26 STGQMTDLIFRERDLLQSLKEYIREEEERLSKIKRWASEVDELSSRSTADPEGYLGHPVNAYKLV 90

  Fly   100 HRLHTSWRKWYQYAIKVENNALGHIENARLMRKMLPTSSDLQQACRGIHDLMSFYDLKPEELAAG 164
            .|.:|.|.....  :.::::|.|.|.|....|:..||..|...|.|.:..:...|.|.|:.:|.|
 Frog    91 KRFNTDWSSLEN--LVLQDSAKGFIANFTFQREYFPTEEDETGAARALMRIQDTYKLDPDVIAKG 153

  Fly   165 NLAGYSQPGT----GLTAYDCLALGEFSVQKREDDLAEAWYNLSLIRFE-------NKFD----- 213
            .|     |||    .|:|.|...:|:.:....:......|...:|.:.:       ||.|     
 Frog   154 KL-----PGTNYISSLSADDSFGMGKIAYHDGDYYHTVLWMQQALKQMDEGEDAVVNKVDVLDYL 213

  Fly   214 KYRVHKAW----GLLLAKNKQLTDA-----------FYHFENKPEGIIASNEVIHFK-------- 255
            .|.|.:..    .|.|.|...:.|.           |...:.|.:..:..||..:.:        
 Frog   214 SYTVFQLGDVPRALELTKRLLVLDPNHDRAVNNLKYFEKMQEKQKAELKQNESTNTESATRQPGV 278

  Fly   256 --------------EELSTKQNCAVVVQKPSRLHCRY-NTTTTPFTRIAPLKMEELGLDPYMVVF 305
                          |.|...:...:..::..||.||| |...:|:..::|:|:|:....|.:|.:
 Frog   279 YSRPLDYLPERDVYEALCRGEGVKMNPRRQRRLFCRYHNGNRSPYLILSPVKVEDEWDSPRIVRY 343

  Fly   306 HDVIYDTEI--------------------DGMLNSSNFGLSLTDSGQKSEVRTSKDSYIVDAKTL 350
            .:.:.|.||                    .|:|:.:|:.:|      ||......|..::  ..:
 Frog   344 LNALSDEEIAKIKELAKPKLARATVRDPKTGVLSVANYRVS------KSAWLEENDDPVI--ARV 400

  Fly   351 NERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRP--------------------- 394
            |.|:..:||.:::.::...:.|||:||.|..|:||     :.||                     
 Frog   401 NLRMQAITGLTVDTAELLQVANYGMGGQYEPHFDF-----SRRPFDSNLKTDGNRLATFLNYKDE 460

  Fly   395 -------KQGDRIATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSA 452
                   ..|:|:||.|.|:.:|::||||:||.....:.||||:|||||||..||..:.::.|:|
 Frog   461 PDVFKRLGTGNRVATFLNYMSDVEAGGATVFPDFGAAIWPKKGTAVFWYNLFRSGEGDYRTRHAA 525

  Fly   453 CPVISGSKYVLTKWINELPQMFVTPC 478
            |||:.|||:|..||.:|..|.|:.||
 Frog   526 CPVLVGSKWVSNKWFHERGQEFLRPC 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 35/131 (27%)
metallo-dependent_hydrolases <237..>306 CDD:294200 17/92 (18%)
P4Hc 313..467 CDD:214780 61/202 (30%)
p4ha2XP_017947536.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.