DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and CG31021

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_733392.2 Gene:CG31021 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster

Alignment Length:478 Identity:128/479 (27%)
Similarity:212/479 (44%) Gaps:82/479 (17%)


  Fly    42 LLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPLNSFRLIHRLHTSW 106
            :|.:|..|:.|::.|.:.|:.|.:|:...:.|.:.:..:...|.|.||.|||||||||..:|..|
  Fly     1 MLNLERNLLQNMRDYAEKLEEKIDLINNYVEDYNVDIEDANEDPEKYLSNPLNSFRLIRHMHQDW 65

  Fly   107 RKWYQYAIK-VENNALGHIENARLMRKMLPTSSDLQQACRGIHDLMSFYDLKPEELAAGNLAGYS 170
            ..|..|... |...|:..:|:   :...||.....::|.|.:|.|..||..:|.:|.|.:....|
  Fly    66 VGWQVYMEDLVAPEAVQKVES---LLPQLPQKEAFRKAARSVHSLTQFYGYEPADLVAKDERSSS 127

  Fly   171 QPGTGLTAYDCLALGEFSVQKREDDLAEA-W-----YNLSLIRFENKFD-----KYRVHKAWGLL 224
               ..|:..||..|| ..:.:.:|.|..| |     :|.:|.|..:.|:     :::|::..|..
  Fly   128 ---LHLSPLDCYHLG-LELYEEQDYLGAAKWLQVAAHNYTLSRHRDLFNPLGAPRWQVYRDLGRT 188

  Fly   225 LAK-NKQLT-DAFYHFENKPEGIIASNEVIHFKEE---------------LSTKQNCAVVVQK-- 270
            |.| |:|.. ||:      ...:..:::.:|..:|               :...|....|::|  
  Fly   189 LLKLNRQCAYDAY------ESALRLNSQNVHLMKEAGQMELFSLRDPMEPILDLQPKPTVLEKYC 247

  Fly   271 -------PSRLHCRYNTTTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLN-------SS 321
                   ..||.|..|.....|...||:|.|:|..||:::::...||:.||..:.|       :.
  Fly   248 RGEVPRHQGRLTCELNDWVHSFLAYAPIKFEDLQQDPFIILYPGSIYEQEIRHVENAYERCPPND 312

  Fly   322 NFGLSLTDSGQKSEVRTSKDSYIVDAKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYD-F 385
            .|.|.|..||     .:..|.|....|.:|||:.||.|.. :..|.|.::.|.    .:..:: |
  Fly   313 RFELKLGISG-----CSISDGYSPVLKRINERILDMAGVE-KTWDTFYIVEYA----QLAPFEPF 367

  Fly   386 HEYTNTTR-PKQG-----DRIATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAM 444
            ..:.|:|: ||..     |..|.|:.:|.:|..|||...|..:|.|.||:|:.:..:.       
  Fly   368 KLFRNSTKFPKLNLMNFEDVEAKVIIFLKDVTLGGAFTMPNGDILVQPKRGNVLITFE------- 425

  Fly   445 NLKSLHSACPVISGSKYVLTKWI 467
            |.:...:.||:|.|:..|:.|:|
  Fly   426 NEEHSTTICPIIEGTGLVMIKFI 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 40/125 (32%)
metallo-dependent_hydrolases <237..>306 CDD:294200 17/93 (18%)
P4Hc 313..467 CDD:214780 46/168 (27%)
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528 39/121 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92001733
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.