DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and CG9698

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_651806.2 Gene:CG9698 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster

Alignment Length:517 Identity:158/518 (31%)
Similarity:247/518 (48%) Gaps:85/518 (16%)


  Fly    32 YAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPLNSF 96
            :.:|..|:.|:...|.::|.:::.::...:.|.:.::..|.:...|..|.:....||..:|:|.:
  Fly    25 FFSSIHEMTKVFGYEQKMVLHMQKFLSDNQDKLDFLKARLREFENERNEAREWGPSYFESPINKY 89

  Fly    97 RLIHRLHTSWRKWYQYAIKVEN---NALGHIENARLM----RKMLPTSSDLQQACRGIHDLMSFY 154
            .|..||...|:       :|||   .:.|.....||.    |:.:|...:|:.|..|:..|...|
  Fly    90 LLNKRLTVDWQ-------RVENLMATSTGEKPLTRLRKFRNRETMPDKKELEGAIDGLLRLQYVY 147

  Fly   155 DLKPEELAAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDLAEAWYNLSLIRFENKF-----DK 214
            .||.::||.|.|.|... ||.|.:..|:.:...:::.:...||.:|    ||...::.     ::
  Fly   148 RLKAKDLARGILDGVDY-GTQLNSEHCVDIARLALRDQHPRLAHSW----LIEANDRLTGGEKEE 207

  Fly   215 YRVHKAWGLLLAKNKQLTDAFYHFENKPEGII----ASNEVIH------FKEELSTKQ------- 262
            ....:...||:...|:|.| |....:..:.:|    ||.|  |      |...||.|.       
  Fly   208 QLKPQILALLVQAKKELED-FRGLNDTYQELIGIQSASEE--HAKNYETFLNALSEKALLNESKP 269

  Fly   263 ----------------------NCA----VVVQKPSRLHCRYNTTTTPFTRIAPLKMEELGLDPY 301
                                  .|:    :..::...|.|.|.|.|.||..|||||.|||..||.
  Fly   270 ILEHAPIPEEGEPVGEFQAYSLTCSGHWRLTPKEQRHLRCGYVTETHPFLWIAPLKAEELFQDPL 334

  Fly   302 MVVFHDVIYDTEIDGMLNSSNFGL---SLTDSGQK--SEVRTSKDSYI-VDA----KTLNERVTD 356
            :|::|||||.:|||.:...:...|   ::|...:.  |.||||:.::| |.|    .|:::||.|
  Fly   335 LVLYHDVIYQSEIDVIRKLTENRLMRATITSHNESVVSNVRTSQFTFIPVTAHKVLSTIDQRVAD 399

  Fly   357 MTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTN-----TTRPKQGDRIATVLFYLGEVDSGGAT 416
            ||..:|:.::.....|||:||||..|.|:...|.     .:.|:.|:|||||||||.:|..||.|
  Fly   400 MTNLNMKYAEDHQFANYGIGGHYGQHMDWFYQTTFDAGLVSSPEMGNRIATVLFYLSDVAQGGGT 464

  Fly   417 IFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWINELPQMFVTPC 478
            .||.:...:.|||.:|.||:|||.||..::::.|.|||:|:|||:|..:||.|..|....||
  Fly   465 AFPQLRTLLKPKKYAAAFWHNLHASGVGDVRTQHGACPIIAGSKWVQNRWIRENDQSDRRPC 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 35/138 (25%)
metallo-dependent_hydrolases <237..>306 CDD:294200 28/112 (25%)
P4Hc 313..467 CDD:214780 68/169 (40%)
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528 35/138 (25%)
P4Hc 345..516 CDD:214780 69/171 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146326762
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.