DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and CG15539

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001036776.1 Gene:CG15539 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster

Alignment Length:505 Identity:158/506 (31%)
Similarity:262/506 (52%) Gaps:64/506 (13%)


  Fly    24 VKSNPK-----KSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKS 83
            |||:.|     .:||.|..::.||::.|..|::.|:.:...|:.:.:.:|..|        || :
  Fly    17 VKSHSKPKILENNYAISIYDMSKLIDYEHYLLNILQKFANALQKRVDTLEYYL--------EM-T 72

  Fly    84 DYE---SYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGH-IENARLMRKMLPTSSDLQQAC 144
            ||:   :...:|:..||:..|||:.:..|..:   :|....|. :::...:...:||..|:::|.
  Fly    73 DYDREKNLAEDPIKHFRITRRLHSDYVNWVWF---MEEQPWGTLVKDIIAIAPEMPTLKDVEEAI 134

  Fly   145 RGIHDLMSFYDLKPEELAAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDLAEAWYNLSLIRFE 209
            ||:..:...|.|...|:|.|.|..... .|.|....|:.:....|..::...|:.|..:.|..:|
  Fly   135 RGLRLIQWTYSLPTAEMAKGVLQDIHH-NTSLDGMQCITIARHMVNYKDFIRAKEWLMVGLKMYE 198

  Fly   210 NKFDKYRVHKAWGLLL---------------AKNKQLTDAFYHFENKPEGIIASNEVIHFK---- 255
            ...:...::...|:.|               ::...:::.....:|.||.:.....:...|    
  Fly   199 ADEEIEYIYSQLGMPLVDFYELFVEIQDELGSRYLAMSELQLAIKNWPEKVSLQRALSRLKMNIR 263

  Fly   256 --EELSTKQN---------CAVVVQKPSRLHCRYNTTTTPFTRIAPLKMEELGLDPYMVVFHDVI 309
              :|.:.|:|         |:...:..::|:|.|.||::.|.|:||||||.|.||||||:||||:
  Fly   264 IGKEPAEKKNKSKRVYKKCCSSECRPTAKLYCLYKTTSSYFLRLAPLKMELLSLDPYMVLFHDVV 328

  Fly   310 YDTEIDGMLNSSNFGLSLT----DSGQKSE--VRTSKDSYIVDAKTLNERVT----DMTGFSMEM 364
            .|.:|..:.|.:...|:.|    ..|..:|  .||:|.:::|:...|.:|::    |||.|.:..
  Fly   329 SDKDIVSIRNLTKGKLARTVTVSKDGNYTEDPDRTTKGTWLVENNALIQRLSQLTQDMTNFDIHD 393

  Fly   365 SDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQGDRIATVLFYLGEVDSGGATIFPMINITVTPKK 429
            :|||.::|||:||.|.:|:||.|  :.......|||||.:|||.:|..|||||||.:.::|.|||
  Fly   394 ADPFQVLNYGIGGFYGIHFDFLE--DAELDNFSDRIATAVFYLSDVPQGGATIFPKLGLSVFPKK 456

  Fly   430 GSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWINELPQMFVTPCM 479
            |||:.||||.:.|..:.::.|||||.:.||::|:||||||..|:|..||:
  Fly   457 GSALLWYNLDHKGDGDNRTAHSACPTVVGSRWVMTKWINEREQIFRRPCL 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 33/135 (24%)
metallo-dependent_hydrolases <237..>306 CDD:294200 29/84 (35%)
P4Hc 313..467 CDD:214780 68/164 (41%)
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528 33/135 (24%)
P4Hc 329..494 CDD:214780 69/167 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146326840
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.