DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and CG31371

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster

Alignment Length:521 Identity:124/522 (24%)
Similarity:217/522 (42%) Gaps:99/522 (19%)


  Fly    24 VKSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMK------ 82
            |:|....::|....:|..||:.|.:|:|.|:.|::.|       ||.|.::.||...::      
  Fly    17 VESVAGANFARGEEQLQALLDTETQLIDGLRDYIERL-------ERQLEEIRRETSAIEEIHSQV 74

  Fly    83 SDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKM--LPTSSDLQQACR 145
            ...|.|:|||||.|.::.|..:.|....|.|    |..|..:...||..:.  ||:..|.:::..
  Fly    75 DSVEEYMGNPLNVFGILKRFESVWPGLEQKA----NATLEMVFGERLSDRQLTLPSEEDYEESLN 135

  Fly   146 GIHDLMSFYDLKPEELAAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDLAEAWYNLSLIRF-- 208
            .:..|.|.|:|....|:.|.:.|: :.|:.::..|||.:    .:|.:..:|..|...:|.:.  
  Fly   136 HLLHLQSVYELDSNSLSLGVVNGF-KLGSSMSWGDCLEV----ARKSDFPVARFWLESALEKLPS 195

  Fly   209 --ENKFDKY------RVH----------------KAWG------LLLAKNKQLTDAFYHFENK-- 241
              ||..:..      |||                :|..      |||..|:.:..|....|..  
  Fly   196 ASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEKAMA 260

  Fly   242 ----PEG----IIASNEVIHFKEELSTKQNCAVVVQK---PSRL-HCRYNTTTTPFTRIAPLKME 294
                |:|    ..|..::....|:|..::.|....|:   .||. ||:.: .::|:..:.|.::|
  Fly   261 KKELPKGRGQKSKAKKQISKSTEQLLIEEICRGAKQQVTTGSRFNHCQLD-GSSPWLLLQPSRLE 324

  Fly   295 ELGLDPYMVVFHDVIYDTEIDGMLNSSNFGLSLTDSGQKSE---VRTSKDSYIVDAKTLNERVTD 356
            .:..|||:|:.|||:...|       ||..|.|.|..:.::   .::.|.|.:...|.  .|::.
  Fly   325 PVSSDPYIVLHHDVLTPKE-------SNELLQLIDEEEDTKGVSYQSLKLSKLAQKKL--GRISR 380

  Fly   357 MTGFSMEMSDPFSLINYGLGGHYMLHYDFHEY-TNTTRPKQGDRIATVLFYLGEVDSGGATIFPM 420
            :.|..:...||::...:|           ||: |......:...:|.::..|.....|||.:||.
  Fly   381 LLGLEILELDPWTGRRHG-----------HEHITKLEHSSELKHVARLMLNLQAPGMGGAVVFPQ 434

  Fly   421 INITVTPKKGSAVFWYNLHNSGA---MNLKSLHSACPVISGSKY-VLTKWINELPQMFVTPCMKD 481
            :.:.|...:||.:.|......|:   .:.:|..:.|||:.|.:. |:....|.|......|..:|
  Fly   435 LELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLGVQLSVIACQSNVLRDTLYGPRGQD 499

  Fly   482 S 482
            |
  Fly   500 S 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 39/139 (28%)
metallo-dependent_hydrolases <237..>306 CDD:294200 19/83 (23%)
P4Hc 313..467 CDD:214780 35/162 (22%)
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 39/137 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146326975
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.