DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and PH4alphaEFB

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_733371.1 Gene:PH4alphaEFB FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster

Alignment Length:533 Identity:160/534 (30%)
Similarity:251/534 (47%) Gaps:116/534 (22%)


  Fly    38 ELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPLNSFRLIHRL 102
            |:.:|||.|..|:.||:||::..:.|.|.::..:.:..||:.:...|..:|:.||:|::.|..||
  Fly    31 EMEELLETESVLITNLEGYIRVQEDKLNFLKNKMDEYQREHSDASHDITAYVSNPINAYLLTKRL 95

  Fly   103 HTSWRKWYQYAIKVENNALGH------IENARLMRKML--PTSSDLQQACRGIHDLMSFYDLKPE 159
            .|.||       :|| |.:.|      ::|....|.:|  |:..||..|...:..|...|.|...
  Fly    96 TTDWR-------QVE-NLMEHDVGTDFLQNITQYRSLLKFPSDEDLNGAAVALLRLQDTYQLDTS 152

  Fly   160 ELAAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDLAEAWYNLSLIRFENK------------- 211
            .:|.|.|.|. |..|.:::.||..||..|....:......|.|.::.|...:             
  Fly   153 SVARGKLNGI-QYSTEMSSDDCFELGRQSYVNHDYYHTVLWMNEAMARMLEEPTNHTQSFTKADI 216

  Fly   212 -----FDKYRVHKAWGLLLAKNKQL-----------TDAFYHFE-------NKPEGIIASNEVIH 253
                 |..|:.......|...|:.|           ...||..|       .|.:|...::|:. 
  Fly   217 LEYLAFSTYKEGNIESALTMTNELLQLLPHHERANGNKRFYEKEIAQQLQLRKMKGDDGTDEMP- 280

  Fly   254 FKEELSTKQNCAVVVQ---------------KPS-----RLHCRYNTTTTPFTRIAPLKMEELGL 298
             |.:|...::...:..               |||     .|.|||.|...||.|:.|||:||:..
  Fly   281 -KSDLPVAKSDPAIFDMTERRAYEMLCRGELKPSPSDLRSLRCRYVTNRVPFLRLGPLKLEEVHA 344

  Fly   299 DPYMVVFHDVIYDTEID--------------------GMLNSSNFGLSLTDSGQKSEVRTSKDSY 343
            |||:|::||.:||:|||                    |.|.::|:.:|     :.:.::|.:|..
  Fly   345 DPYIVIYHDAMYDSEIDLIKRMARPRFRRATVQNSVTGALETANYRIS-----KSAWLKTQEDRV 404

  Fly   344 IVDAKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQ--------GDRI 400
            |   :|:.:|..||||..|:.::...::|||:||||..|:||     ..:.:|        |:||
  Fly   405 I---ETVVQRTADMTGLDMDSAEELQVVNYGIGGHYEPHFDF-----ARKEEQRAFEGLNLGNRI 461

  Fly   401 ATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTK 465
            ||||||:.:|:.||||:|..::..:.||||:|.||.|||..|..::::.|:||||::|:|:|..|
  Fly   462 ATVLFYMSDVEQGGATVFTSLHTALFPKKGTAAFWMNLHRDGQGDVRTRHAACPVLTGTKWVSNK 526

  Fly   466 WINELPQMFVTPC 478
            ||:|..|.|..||
  Fly   527 WIHERGQEFRRPC 539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 41/136 (30%)
metallo-dependent_hydrolases <237..>306 CDD:294200 26/96 (27%)
P4Hc 313..467 CDD:214780 64/182 (35%)
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528 41/136 (30%)
P4Hc 356..529 CDD:214780 67/186 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146326639
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.