DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and CG11828

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_651648.5 Gene:CG11828 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster

Alignment Length:501 Identity:140/502 (28%)
Similarity:228/502 (45%) Gaps:102/502 (20%)


  Fly    39 LMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPLNSFRLIHRLH 103
            :..||::||||:..::.|...|:.|.|.|.....:.........:|..||:.|||.||.|:.|.:
  Fly     1 MASLLQIEDELIGYMRQYAMELQHKVNTMRTFQEEWMTRRALGPADPTSYVANPLISFPLMRRTY 65

  Fly   104 TSWRKW------------YQYAIKVENNALGHIENARLMRKMLPTSSDLQQACRGIHDLMSFYDL 156
            |...|.            :|..|..:.:::..:|              |:.|..|:......|.:
  Fly    66 TDVPKLLELAREEFKPGPFQKFIDYDLSSISDVE--------------LETAVTGMLRFQGVYGM 116

  Fly   157 KPEELAAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDLAEAWYNLSLIRFENKFD-------- 213
            ...|:|.|.|.| .|..:.::|.||||:........:..||..|:.:::.::|.|.|        
  Fly   117 DESEMANGKLHG-KQYNSRMSAADCLAVATHLENVDKGKLACKWFKVAIDQYEEKLDPVNRLLQT 180

  Fly   214 -KYRVHKAWGLLL-------------------AKNKQLTDAFYHFENKPEGIIASNEVIHFKEEL 258
             :.::::..||.|                   |..:..||...|.::|     .::..:|.    
  Fly   181 GRSQIYEKLGLTLLAMHDLPASQAAFRDSIGWASKEDNTDLAKHLKDK-----LAHMFVHV---- 236

  Fly   259 STKQNCAVVVQKPSR--LHCRYNTTTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSS 321
               .||......||:  |.|||....:||.|:||:|:|:|.::|::.:|||.|...|...:|:  
  Fly   237 ---DNCRGKNLLPSKSYLRCRYLRDGSPFLRMAPVKLEQLNIEPFVGLFHDAISPAEQKDLLH-- 296

  Fly   322 NFGLSLTDSGQKSEVRTSKDSYIVDAKT----------LNERVTDMTGFSMEMSDPFSLINYGLG 376
                 ||||  :.|.| .|||..|:||.          :::|:.|:|||.:|.|:|.::.|||:|
  Fly   297 -----LTDS--RLEHR-KKDSSSVEAKVDTNASDHVRRIHQRIEDITGFDLEESEPLTVSNYGIG 353

  Fly   377 GHYMLHYDFHEYTNTTRPKQ-------GDRIATVLFYLGEVDSGGATIFPMINITVTPKKGSAVF 434
            |...:|.|..:      ||:       ..|.|:.:|||.:|..||...||.:.....|::|||:.
  Fly   354 GQDFIHLDCEQ------PKEFIGYYPKEYRSASAMFYLSDVQMGGYASFPDLGFGFKPRRGSALV 412

  Fly   435 WYNLHNSGAMNLKSLHSACPVISGSKYVLTKWINELPQMFVTPCMK 480
            |:|..|||..:.:||.:.|||:.|:::|..|||:...|.....|.|
  Fly   413 WHNTDNSGNCDTRSLQATCPVLLGNQWVAKKWISGSGQWRRKSCRK 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 33/139 (24%)
metallo-dependent_hydrolases <237..>306 CDD:294200 21/71 (30%)
P4Hc 313..467 CDD:214780 59/171 (35%)
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528 33/139 (24%)
P4Hc 287..445 CDD:214780 59/174 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146329375
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.