DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and CG18233

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_649044.3 Gene:CG18233 FlyBaseID:FBgn0036795 Length:515 Species:Drosophila melanogaster

Alignment Length:519 Identity:167/520 (32%)
Similarity:266/520 (51%) Gaps:72/520 (14%)


  Fly    14 SACFINCQGFVKSNP-----KKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLID 73
            :|..|..|....::|     :|.|::|.:.|:|||::|.|.:.|...|...|:.|.:.:...|..
  Fly     8 AAVLILVQSIHSTDPNDFLNRKYYSSSVLGLVKLLKMEQEFMVNFSIYANILQEKVDNLNIFLDA 72

  Fly    74 MSRENMEMKSDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKML---P 135
            :.|.|.:..::.|.::.||||:|.||.||:..|.|...|..|    .|| :|....|:.::   |
  Fly    73 LKRPNHKTHNEREKFVSNPLNAFGLIRRLNQDWPKLQNYTQK----PLG-LEQLTAMQDIVSAAP 132

  Fly   136 TSSDLQQACRGIHDLMSFYDLKPEELAAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDLAEAW 200
            .|.|:.:..:.:|.:.:.|||:|:::|.| |...::....|...|||||.....:..|...:..|
  Fly   133 ESFDMNEKLKAMHRIETTYDLQPKDIAKG-LLQRTEFNYRLLFRDCLALAYHKFEIGEFKRSLLW 196

  Fly   201 YNLSL-------IRFENKFDKYRVHKAWGLLLAK-------------------NKQLTDA-FYHF 238
            :..:|       :...|:..:..: |.:...:||                   |.||.|| ....
  Fly   197 FQEALKLSTDGSLEIMNRLKEIEL-KGFATAVAKRSIYLSNQGLTNETIDDMANSQLQDAKLMDL 260

  Fly   239 ENKPEGIIASNEVIHFKEELST------KQNCAVVVQKPSRLHCRYNTTTTPFTRIAPLKMEELG 297
            |.     :.|:|:..:..:.||      ...|..:..|.|.|.||||::|..|.::|||||||:.
  Fly   261 EQ-----LISSELKQWINDDSTTPPTDHNLGCRGLFPKKSNLVCRYNSSTNAFLKLAPLKMEEIS 320

  Fly   298 LDPYMVVFHDVIYDTEIDGMLNS-SNFGLSLTDSGQKSEVRT-----SKDSYIVDAKTLNERVTD 356
            .|||:|:||:||.|.:|:.|... :......|..|...|:.:     .|:|..  :|.:|:|::|
  Fly   321 RDPYIVMFHEVISDKDIEEMKGEITEMENGWTSLGDPKEIVSRVYWIRKESSF--SKRINQRISD 383

  Fly   357 MTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQ-------GDRIATVLFYLGEVDSGG 414
            ||||.:|......|.|:|:||::..||||:    |.|.|:       ||||.:::||.|||..||
  Fly   384 MTGFKLEEFPAIQLANFGVGGYFKPHYDFY----TDRLKEVDVNNTLGDRIGSIIFYAGEVSQGG 444

  Fly   415 ATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWINELPQMFVTPC 478
            .|:||.:.:.|.||||:|:||:|..:....:.:||||.|||:.||::.:|||::..||:||.||
  Fly   445 QTVFPDLKVAVEPKKGNALFWFNAFDDSTPDPRSLHSVCPVLVGSRWTITKWLHYAPQLFVKPC 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 42/134 (31%)
metallo-dependent_hydrolases <237..>306 CDD:294200 27/75 (36%)
P4Hc 313..467 CDD:214780 63/167 (38%)
CG18233NP_649044.3 P4Ha_N 34..163 CDD:285528 43/135 (32%)
ATP-synt_B <198..278 CDD:304375 15/86 (17%)
P4Hc 333..498 CDD:214780 64/171 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146332169
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.