DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and CG18234

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_649043.3 Gene:CG18234 FlyBaseID:FBgn0265268 Length:515 Species:Drosophila melanogaster

Alignment Length:526 Identity:153/527 (29%)
Similarity:245/527 (46%) Gaps:79/527 (15%)


  Fly     1 MYILKNLTLIGF---LSACFINCQGFVKSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKM 62
            |:|:.::.||..   :..|.|.           :.|.|...:.:|:::|...:..::.|...||.
  Fly     1 MFIILSICLISLGPPIGLCEIT-----------NSAMSIAGMKELVDLEGFFISEMESYTAALKN 54

  Fly    63 KFNLMERSLIDMSRENMEMKSDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENA 127
            |.:|||..|.::..:....:.:.|.::.:|||:|.||.|||..|.:  ...:.:....|.|::..
  Fly    55 KIDLMESLLQEVQSKREISRRNPEEFVAHPLNAFSLIRRLHEDWTQ--AELLMLNQVGLEHLQAI 117

  Fly   128 RL-MRKMLPTSSDLQQACRGIHDLMSFYDLKPEELAAGNLAGYSQPGTGLTAYDCLALGEFSVQK 191
            .. :.:..|:.:||..|..||..|..||:|:|.::|.|.|.| .|....||..:|.||....:..
  Fly   118 ETGLEEAQPSDNDLNDAIGGIISLQQFYNLQPSDIANGLLMG-QQYNASLTTLNCQALANACMNF 181

  Fly   192 REDDLAEAWYNLSLIRFENKFDKYRVHKAWGLLLAKNKQLTDAFYHFEN--KPEGI-IASNEVIH 253
            ..|..|..|:..::..:.:..|.....:.:..      :|.|.:.::.:  ..:|. .|:.:|:.
  Fly   182 NYDKYALNWFKAAVDHYNDDRDGQVYREVFDF------RLPDLYINYTSVLVTKGFRKAAWKVLQ 240

  Fly   254 FKEELSTK-----------------------------QNCAVVVQKPSRLHCRYNTTTTPFTRIA 289
            ...:|...                             ..|..|.|....|.|.|...|:.|.|||
  Fly   241 DVADLDATLWLLRKDIYEVGKIDVPDPTFIITPWFDVTGCLRVGQTSQHLSCHYEKNTSEFLRIA 305

  Fly   290 PLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGLSLTDSGQKSEVRTSKDSYIVD-----AK- 348
            |||:|.|.|.|::|::||||||:||..:.|.|...|       ||.:|.   .|.:|     || 
  Fly   306 PLKVETLSLKPHIVLYHDVIYDSEISKVKNISLPSL-------KSPLRI---LYAIDYNLKFAKI 360

  Fly   349 ------TLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQGDRIATVLFYL 407
                  .|:.|:.||||..::....|.:.|||:.|....|.|..|..:.| .:.|||:.:::|::
  Fly   361 REDHQSPLSLRIKDMTGEDVQEDTDFQIDNYGICGFRNFHTDNIELQDQT-AELGDRLTSIMFFM 424

  Fly   408 GEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWINELPQ 472
            .:|..|||..||.:|:|:.|:||||:.|.||.:....|...||.:|||:.|||:.|.||::|.||
  Fly   425 NDVAQGGALAFPNLNLTIWPQKGSALVWRNLDHRMQPNQDLLHVSCPVVVGSKWTLVKWLHERPQ 489

  Fly   473 MFVTPC 478
            ||..||
  Fly   490 MFSRPC 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 37/132 (28%)
metallo-dependent_hydrolases <237..>306 CDD:294200 23/101 (23%)
P4Hc 313..467 CDD:214780 59/166 (36%)
CG18234NP_649043.3 P4Ha_N 27..157 CDD:285528 37/132 (28%)
P4Hc <371..485 CDD:214780 46/115 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146327895
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.