DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and CG4174

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001034031.2 Gene:CG4174 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster

Alignment Length:497 Identity:121/498 (24%)
Similarity:225/498 (45%) Gaps:72/498 (14%)


  Fly    13 LSACF-INCQGFVKSNPKK-SYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMS 75
            ::||. ...:|.|.|.|:. .:|.|:...:.||::::..|:||:.|.|.||.....:.|::    
  Fly     8 VTACLGFQVKGEVVSAPESYDFAISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIRRAI---- 68

  Fly    76 RENMEMKSDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKMLPTSSDL 140
            |::.|:....::...|.:..::::..||..|.::::...|  :..|..|..::::....|||.|.
  Fly    69 RQSEELLKSTKTSPRNLIYGYKVLRHLHNDWPQYFRLLKK--DLGLEQIAVSQMLLTQQPTSVDF 131

  Fly   141 QQACRGIHDLMSFYDLKPEELAAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDLAEAWYNLSL 205
            :::...:|.|.:.|:|....:..|.:....:.....:|.:||.||...:..::.:.:|.|..|:|
  Fly   132 EESMGAMHRLQTVYNLDSYAMTEGFIDDKDKNIRNWSADECLMLGLMYLFLKDYNQSENWLELAL 196

  Fly   206 IRF-ENKFDKYRVHKAWGL------LLAKNKQLTDAF--------------------------YH 237
            ..: :|...:....|.|..      |:..||.|...|                          .|
  Fly   197 YHYDDNVSPEVLKIKLWNYPNLLESLVEANKGLGHYFEAKKYANELLSINPNHTYMLTQLPKLKH 261

  Fly   238 FENKPEGIIASNEVIHFKEELSTKQNCAVVVQKPSRLHCRYNTTTTPFTRIAPLKMEELGLDPYM 302
            .::.|..:....:|...::|:.:|:    ..:|...|.||| ...|||.::||||||||.:.||:
  Fly   262 LQSNPAKLTKPKKVFQLQKEICSKR----YRRKSGVLVCRY-VDWTPFLKLAPLKMEELSMKPYI 321

  Fly   303 VVFHDVIYDTEIDGMLNSSNFGLSLTD--SGQKS----EVRTSKDSYIVDAKTLNERVTDMTGFS 361
            .:|:..:...:|:.:.|.|...|...:  ||..|    .:.||....:   :.:||.:..:|||.
  Fly   322 SIFYGFLGQKDIEVLKNVSRPKLQRIEHLSGNCSCKIGNLSTSLHDVV---RKVNELILGITGFP 383

  Fly   362 MEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQGDRIATVLFYLGEVDSGGATIFPMINITVT 426
            ::.:....:||||:.|:|          |...||..:: |....:|.....||..:||..::.|.
  Fly   384 LKGNQMLEVINYGIAGNY----------NPEEPKIHNK-ANAFIFLSNAGKGGEIVFPSRHLKVR 437

  Fly   427 PKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWIN 468
            |:|||.:.|.||..|      .::..||::.|:.:|..|.:|
  Fly   438 PRKGSMLVWENLKKS------LIYHQCPILKGNMWVANKVLN 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 29/131 (22%)
metallo-dependent_hydrolases <237..>306 CDD:294200 24/69 (35%)
P4Hc 313..467 CDD:214780 43/160 (27%)
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 28/130 (22%)
TPR repeat 169..197 CDD:276809 9/28 (32%)
TPR repeat 202..245 CDD:276809 8/43 (19%)
2OG-FeII_Oxy <362..470 CDD:304390 35/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146329924
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.