DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and CG34041

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster


Alignment Length:349 Identity:74/349 - (21%)
Similarity:160/349 - (45%) Gaps:70/349 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SACFINCQGFV-----KSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLID 73
            |||.::. |.:     .||.:..::.|..:::.:|::::.:|..|:.|:..|:.|...::.:|||
  Fly   235 SACILSV-GLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALID 298

  Fly    74 MSRENMEMKSDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLM--RKMLPT 136
            ::..:::.:.|..:...:|:.|:.|||.:.:.|..|..:.    ....|..|.|.||  :|.|||
  Fly   299 LATYHIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFL----QEDPGKDELASLMSIKKYLPT 359

  Fly   137 SSDLQQACRGIHDLMSFYDLKPEELAAGNLAG----YSQPGTGL--------------TAYDCLA 183
            .:|:.:.|.||..:::.|.:..:::|.|.:.|    |......|              :..||:|
  Fly   360 KNDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVA 424

  Fly   184 LGEFSVQKREDDLAEAWYNLSLIRFENK----------------FDKYRVHKAWGLLLAKNKQLT 232
            |.:.|::.::.:.::.|.|:::...|:.                .:.|...:.|.|.|...:   
  Fly   425 LSDHSMEMKDYNKSKEWLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVE--- 486

  Fly   233 DAFYHFENKPEGIIASNEVIHFKEELS-------------TKQNCAVVVQKPSRLHCRYNT-TTT 283
               :..::.|.    :.::|..::.||             ..:|....::|...|:|.|:| ..|
  Fly   487 ---FALKSNPR----NAQLIRMQKRLSYHILLGPPKSPKLNIENNDYRLRKNGSLYCFYDTKIRT 544

  Fly   284 PFTRIAPLKMEELGLDPYMVVFHD 307
            .::.:||:|.|.|.:||.::::|:
  Fly   545 FYSLLAPIKAEVLFIDPLVILYHE 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 34/132 (26%)
metallo-dependent_hydrolases <237..>306 CDD:294200 18/82 (22%)
P4Hc 313..467 CDD:214780
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 34/132 (26%)
TPR repeat 452..491 CDD:276809 4/44 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461981
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.