DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and CG18749

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001027154.1 Gene:CG18749 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster

Alignment Length:491 Identity:443/492 (90%)
Similarity:465/492 (95%) Gaps:1/492 (0%)


  Fly     1 MYILKNLTLIGFLSACFINCQGFVKSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFN 65
            |||||.||.|||||||||||||||.||||||||||||||||||||||||||||||||||||||||
  Fly     1 MYILKKLTFIGFLSACFINCQGFVNSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFN 65

  Fly    66 LMERSLIDMSRENMEMKSDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLM 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 LMERSLIDMSRENMEMKSDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLM 130

  Fly   131 RKMLPTSSDLQQACRGIHDLMSFYDLKPEELAAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDD 195
            |||||||||||||||||||||.|||||||||||||||||||||||||||||||||||.||.::||
  Fly   131 RKMLPTSSDLQQACRGIHDLMYFYDLKPEELAAGNLAGYSQPGTGLTAYDCLALGEFGVQNQKDD 195

  Fly   196 LAEAWYNLSLIRFENKFDKYRVHKAWGLLLAKNKQLTDAFYHFENKPEGIIASNEVIHFKEELST 260
            ||||||||||.||:|..:||:|||||.||||||||||:||.|||||||||:||||||||:..|:|
  Fly   196 LAEAWYNLSLTRFDNIIEKYQVHKAWALLLAKNKQLTEAFQHFENKPEGIVASNEVIHFEGVLAT 260

  Fly   261 KQNCAVVVQKPS-RLHCRYNTTTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFG 324
            .|||..|||||| :|||||||:||||||||||||||||||||||||||||||||||||||||:||
  Fly   261 TQNCTAVVQKPSKKLHCRYNTSTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSDFG 325

  Fly   325 LSLTDSGQKSEVRTSKDSYIVDAKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYT 389
            ||.:.||.||||||||||:||||||||||||||||.||||||||||||||||||::||:||||||
  Fly   326 LSESVSGLKSEVRTSKDSHIVDAKTLNERVTDMTGLSMEMSDPFSLINYGLGGHFILHHDFHEYT 390

  Fly   390 NTTRPKQGDRIATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACP 454
            ||||.|||||||||||||.||||||||:|||:||||.|||||||||||||||||:|.|:||:|||
  Fly   391 NTTRLKQGDRIATVLFYLREVDSGGATVFPMLNITVMPKKGSAVFWYNLHNSGAVNSKTLHTACP 455

  Fly   455 VISGSKYVLTKWINELPQMFVTPCMKDSNLHPPQKE 490
            ||||||||||||||||||||||||||||||.|||||
  Fly   456 VISGSKYVLTKWINELPQMFVTPCMKDSNLRPPQKE 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 130/131 (99%)
metallo-dependent_hydrolases <237..>306 CDD:294200 59/70 (84%)
P4Hc 313..467 CDD:214780 135/154 (88%)
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528 130/131 (99%)
P4Hc 314..468 CDD:214780 135/154 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146326041
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.