DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and p4ha2

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_005173949.1 Gene:p4ha2 ZFINID:ZDB-GENE-030827-1 Length:542 Species:Danio rerio

Alignment Length:539 Identity:142/540 (26%)
Similarity:245/540 (45%) Gaps:103/540 (19%)


  Fly    26 SNPKKSYAASTM-ELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYL 89
            |:|.::...::: ::..|:..|.|||.:||.|::..:.|...:......:.:......||.|.:|
Zfish    15 SSPTRAEIFTSIGQMTNLIFTERELVQSLKEYIQAEEQKLETVRSWANKLDKLTRTSTSDPEGFL 79

  Fly    90 GNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKMLPTSSDLQQACRGIHDLMSFY 154
            .:|:|:::|:.||:|.|.:  ..::.:::.:.|.|.|..:.|:..|...|.:.|.:.:..|...|
Zfish    80 AHPVNAYKLMKRLNTEWSE--LESLVLQDPSDGFISNMSVHRQYFPDEEDEKGAAKALLRLQDTY 142

  Fly   155 DLKPEELAAGNLAGYSQPGTG------LTAYDCLALGEFSVQKREDDLAEAWYNLSLIRFEN--- 210
            .|..|..:.|.|.|..| .:|      ||..||..:|:.:....:...:..|...||.:.::   
Zfish   143 KLDAESFSKGKLPGQRQ-HSGVRYNALLTVDDCFDMGKMAYNDNDYYHSVLWMQQSLRQMDSGEE 206

  Fly   211 ----KFD-----KYRVHKAWGL---------LLA------------------KNKQLTDA----- 234
                |.|     .|.|::...|         |||                  .:|:|.|:     
Zfish   207 AKTPKADVLDYLSYSVYQMGDLPRAIELTRRLLAIDPSHQRAGGNLRYFERLLSKELQDSGQTQP 271

  Fly   235 -----------FYHFENKPEGIIASNEVIHFKEELSTKQNCAVVVQKPSRLHCRY-NTTTTPFTR 287
                       .|   .:|:..:...|..   |.|...:...:..::.|||.||| :....|...
Zfish   272 EPADERPIQLDTY---QRPKDYLPEREAY---EALCRGEGVKMTTKRQSRLFCRYRDGNRNPRLL 330

  Fly   288 IAPLKMEELGLDPYMVVFHDVIYDTEID--------------------GMLNSSNFGLSLTDSGQ 332
            :.|:|.|:....|::|.|.:.:.|.||.                    |:|..:::.:|      
Zfish   331 LKPMKEEDEWDSPHIVRFLEALSDEEIQKIKEIATPKLARATVRDPKTGVLTVAHYRVS------ 389

  Fly   333 KSEVRTSKDSYIVDAKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQ- 396
            ||.....:|..::  ..:|:|:.|:||.:::.::...:.|||:||.|..|:||.........|. 
Zfish   390 KSAWLEGEDDPVI--ARVNQRIEDITGLTVDTAELLQVANYGVGGQYEPHFDFSRKDEPDAFKSL 452

  Fly   397 --GDRIATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGS 459
              |:|:||.|.|:.:|::||||:||....:|.|:||:|||||||..||..:.::.|:||||:.||
Zfish   453 GTGNRVATYLNYMSDVEAGGATVFPDFGASVWPRKGTAVFWYNLFRSGEGDYRTRHAACPVLVGS 517

  Fly   460 KYVLTKWINELPQMFVTPC 478
            |:|..|||:|..|.|..||
Zfish   518 KWVSNKWIHERGQEFRRPC 536

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 32/132 (24%)
metallo-dependent_hydrolases <237..>306 CDD:294200 17/70 (24%)
P4Hc 313..467 CDD:214780 60/177 (34%)
p4ha2XP_005173949.1 P4Ha_N 25..154 CDD:285528 32/131 (24%)
P4Hc 353..526 CDD:214780 62/181 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.