DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and P4ha3

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_008757983.1 Gene:P4ha3 RGDID:735150 Length:569 Species:Rattus norvegicus

Alignment Length:570 Identity:155/571 (27%)
Similarity:241/571 (42%) Gaps:158/571 (28%)


  Fly    31 SYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSR---ENMEMKSDYESYLGNP 92
            :::|.| .:.:.|..|..|:..|:.|::.       .|..|.|::|   :.:.:..|.:..:.||
  Rat    30 TFSALT-SVARALAPERRLLGTLRRYLRG-------EEARLRDLTRFYDKVLSLHEDLKIPVVNP 86

  Fly    93 LNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLMR-------KMLPTSSDLQQACRGIHDL 150
            |.:|.||.||.:.||...        ::|...||.|.::       :.||...||:.|.|.:..|
  Rat    87 LLAFTLIKRLQSDWRNVV--------HSLEATENIRALKDGYEKVEQDLPAFEDLEGAARALMRL 143

  Fly   151 MSFYDLKPEELAAGNLAGYSQPGTG--------------LTAYDCLALG---------------- 185
            ...|.|..:.||    .|..|..||              |||.||..:|                
  Rat   144 QDVYMLNVKGLA----QGVFQRVTGSSITDLYSPRQLFSLTADDCFQVGKVAYDTGDYYHAIPWL 204

  Fly   186 ------------------EFSVQKREDDLAEAWYN-------LSLIRFENKFDKYRVHKAWG--- 222
                              |.|::...|.||.|.|.       |||.|   :|..| :..|||   
  Rat   205 EEAVSLFRRSYGEWKTEDEASLEDALDYLAFACYQVGNVSCALSLSR---EFLVY-MAGAWGSQK 265

  Fly   223 -------------------------------LLLAKNKQLTDAFYHFENKPEGIIASNEVIHFKE 256
                                           .|||:|..|..|        |..|....|.|.:.
  Rat   266 TNSLELEFQTVGSGCQGPDNKRMARNVLKYERLLAENGHLMAA--------ETAIQRPNVPHLQT 322

  Fly   257 ELSTKQNCAVVVQKPSR-----LHCRYNTTTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDG 316
            ..:.:..|..:..:|:.     |:|.|.|.::|:..:.|.:.|.:.|.|.:.::||.:.|.|...
  Rat   323 RDTYEGLCQTLGSQPTHYQIPSLYCSYETNSSPYLLLQPARKEVIHLRPLVALYHDFVSDEEAQK 387

  Fly   317 MLNSSNFGL--SLTDSGQKS---EVRTSKDSYIVDA-----KTLNERVTDMTGFSMEMSDPFS-- 369
            :...:...|  |:..||:|.   |.|.||.:::.|.     .||:.|:..:||  :::..|::  
  Rat   388 IRELAEPWLQRSVVASGEKQLQVEYRISKSAWLKDTVDPVLVTLDRRIAALTG--LDIQPPYAEY 450

  Fly   370 --LINYGLGGHYMLHYDFHEYTNTTRP----KQGDRIATVLFYLGEVDSGGATIFPMINITVTPK 428
              ::|||:||||..|:|  ..|:.:.|    |.|:|:||::.||..|::||||.|...|.:|...
  Rat   451 LQVVNYGIGGHYEPHFD--HATSPSSPLYKMKSGNRVATLMIYLSSVEAGGATAFIYGNFSVPVV 513

  Fly   429 KGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWINELPQMFVTPC 478
            |.:|:||:|||.||..:..:||:.|||:.|.|:|..|||:|..|.|..||
  Rat   514 KNAALFWWNLHRSGEGDDDTLHAGCPVLVGDKWVANKWIHEYGQEFRRPC 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 36/141 (26%)
metallo-dependent_hydrolases <237..>306 CDD:294200 15/74 (20%)
P4Hc 313..467 CDD:214780 62/172 (36%)
P4ha3XP_008757983.1 P4Ha_N 33..159 CDD:285528 38/146 (26%)
P4Hc 381..553 CDD:214780 64/176 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92172952
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.851 Consistency score
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.