DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and P4ha2

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001101745.1 Gene:P4ha2 RGDID:1309673 Length:535 Species:Rattus norvegicus

Alignment Length:514 Identity:145/515 (28%)
Similarity:244/515 (47%) Gaps:74/515 (14%)


  Fly    32 YAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPLNSF 96
            :..|...:..|:..|.:||.:||.|:...:.|.:.::.....|.....:..:|.|.||.:|:|::
  Rat    23 FFTSIGHMTDLIYAEKDLVQSLKEYILAEEAKLSKIKSWASKMEALTSKSAADPEGYLAHPVNAY 87

  Fly    97 RLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKMLPTSSDLQQACRGIHDLMSFYDLKPEEL 161
            :|:.||:|.|.....  :.:::.|.|.:.|..:.|:..||..|...|.|.:..|...|.|.|:.:
  Rat    88 KLVKRLNTDWPALGD--LVLQDAAAGFVANLSVQRQFFPTDEDESGAARALMRLQDTYKLDPDMI 150

  Fly   162 AAGNLAGYSQPGTG----LTAYDCLALGEFS---------------VQKREDDLAEAWYNLSLIR 207
            :.|.|     |||.    |:..||..:|..:               |.|:.|...||....||:.
  Rat   151 SRGEL-----PGTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATVTKSLVL 210

  Fly   208 FENKFDKYR---VHKAWGL---LLA---KNKQLTDAFYHFE------------NKPEGIIASNEV 251
            ....:..::   :|:|..|   ||:   .:::......:||            |:.:..:||.|.
  Rat   211 DYLSYAVFQLGDLHRAVELTRRLLSLDPSHERAGGNLRYFERLLEEERGKSLSNQTDAGLASQEN 275

  Fly   252 IHFK-----------EELSTKQNCAVVVQKPSRLHCRY-NTTTTPFTRIAPLKMEELGLDPYMVV 304
            ::.:           |.|...:...:..::..||.||| :....|...|||.|.|:....|::|.
  Rat   276 LYERPVDYLPERDVYESLCRGEGIKMTPRRQKRLFCRYHHGNRVPQLLIAPFKEEDEWDSPHIVR 340

  Fly   305 FHDVIYDTEIDGMLNSSNFGLS-LTDSGQKSEV------RTSKDSYIVD-----AKTLNERVTDM 357
            ::||:.|.||:.:...:...|: .|....|:.|      |.||.|::.:     ...:|.|:..:
  Rat   341 YYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHI 405

  Fly   358 TGFSMEMSDPFSLINYGLGGHYMLHYDF---HEYTNTTRPKQGDRIATVLFYLGEVDSGGATIFP 419
            ||.:::.::...:.|||:||.|..|:||   .|.....|...|:|:||.|.|:.:|::||||:||
  Rat   406 TGLTVKTAELLQVANYGMGGQYEPHFDFSRSDERDAFKRLGTGNRVATFLNYMSDVEAGGATVFP 470

  Fly   420 MINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWINELPQMFVTPC 478
            .:...:.||||:|||||||..||..:.::.|:||||:.|.|:|..||.:|..|.|:.||
  Rat   471 DLGAAIWPKKGTAVFWYNLLRSGEGDYRTRHAACPVLVGCKWVSNKWFHERGQEFLRPC 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 35/131 (27%)
metallo-dependent_hydrolases <237..>306 CDD:294200 21/93 (23%)
P4Hc 313..467 CDD:214780 61/169 (36%)
P4ha2NP_001101745.1 P4Ha_N 26..155 CDD:285528 35/131 (27%)
P4Hc 346..519 CDD:214780 62/173 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.