DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and PH4alphaNE3

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_651814.1 Gene:PH4alphaNE3 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster

Alignment Length:466 Identity:143/467 (31%)
Similarity:240/467 (51%) Gaps:47/467 (10%)


  Fly    40 MKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPLNSFRLIHRLHT 104
            |.|::::.||:|||..|.:.:..|.:.::|...::.:.....|...|.||||||:||.||..::.
  Fly    25 MDLMQLDVELIDNLMNYAEKIDEKASQLKRLAQELRQPLHSAKGREEEYLGNPLHSFPLIRHMYQ 89

  Fly   105 SWRKWYQYAIKVENNALGHIENARLMRKM--LPTSSDLQQACRGIHDLMSFYDLKPEELAAGNLA 167
            .||    |..:.....:|..|...|.||:  ||...|.::|...|..:...|.:.|.::|.|.:.
  Fly    90 DWR----YLEEFMKKPVGEEEIQFLRRKLPELPWQVDTEEASVSIFRIAETYGMMPWDMANGLID 150

  Fly   168 GYSQPGTGLTAYDCLALGEFSVQKREDDLAEAWYNLSLIRFENKFDKYRVHKAWGL--------- 223
            ......| |.|.||..:.:...:......|..|..:|..|.:.::.  .|::..|:         
  Fly   151 NVRFNST-LPALDCFEVAKMYFKWGYFKQALQWITISKARMKEEYS--GVYEVLGMNRQDVALLQ 212

  Fly   224 --LLAKNKQLTDAFYHFENKPEGIIASNEVI---HFK----EELST--------KQNC-AVVVQK 270
              .|.:..:..:|.....::|:  :|.|.:.   .||    |.:.:        |:.| :.....
  Fly   213 ARCLVELDRRDEAHEVLLDQPD--LADNSISLLDQFKANPYEAIDSSPKLGEGYKRLCRSSFSPN 275

  Fly   271 PSRLHCRYNTTTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGLSLTD------ 329
            ||:||||||:||:.|..:|||||||:.|:|::||:||::.|.:|..::..:...|..|:      
  Fly   276 PSKLHCRYNSTTSAFLILAPLKMEEISLEPHIVVYHDILPDKDIQQLITLAEPLLKPTEMFDDNK 340

  Fly   330 SGQKSEVRTSKDSYIVDAKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRP 394
            :..:|..||.....::|  :|.:|:.|:||..:...:|.::|.||.|..|..:|||.:..|:...
  Fly   341 NEARSSYRTPLGGPLLD--SLTQRMRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKKRNSESK 403

  Fly   395 KQGDRIATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLH-NSGAMNLKSLHSACPVISG 458
            ..|||:||.:|||.:...||||:||.:|:.|..::|..:|||||: ::..|...::|:||||..|
  Fly   404 GFGDRMATFMFYLNDAPYGGATVFPRLNVKVPAERGKVLFWYNLNGDTHDMEPTTMHAACPVFHG 468

  Fly   459 SKYVLTKWINE 469
            ||:|:|.||:|
  Fly   469 SKWVMTAWIHE 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 39/128 (30%)
metallo-dependent_hydrolases <237..>306 CDD:294200 30/85 (35%)
P4Hc 313..467 CDD:214780 56/161 (35%)
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528 39/128 (30%)
P4Hc 316..478 CDD:214780 58/164 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146326573
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.