DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and CG31016

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001263119.1 Gene:CG31016 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster

Alignment Length:516 Identity:170/517 (33%)
Similarity:262/517 (51%) Gaps:72/517 (14%)


  Fly    29 KKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPL 93
            :::|..|..|.|.|||.:.||:..|..|...|..|..:::|.:.:..:...:.|:..|.||.||:
  Fly    25 RQNYVISVEEKMDLLEKDRELIIVLDSYATELNEKIIMLKRIVKEFKQPLEKAKNREEEYLSNPI 89

  Fly    94 NSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKM---LPTSSDLQQACRGIHDLMSFYD 155
            :|..|:.::|..|.|    ..|:....:|. |...|:.||   ||..:||.:|.:.:..::..||
  Fly    90 DSLSLMRQMHEDWEK----VEKLLKKPVGQ-EKIALVEKMREDLPVENDLMEANQAMFRILHTYD 149

  Fly   156 LKPEELAAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDLAEAWYNLSLIRFENKFDKYRVHKA 220
            |:|::::||.:.|. |.|..::|.||..:|.||.......:|..|.:.:.....::..||  |:.
  Fly   150 LEPKDVSAGWIDGV-QYGGKMSASDCFTMGTFSFMAGSYQIASKWLSAAKDLLVDQPRKY--HEV 211

  Fly   221 WG-------LLLAKN-------KQLTDAF--------------YHF-ENKPEGIIASNEVIHFKE 256
            .|       ||||::       ...||..              .|| .|||:   .|..:..::.
  Fly   212 MGITKADVTLLLARSLIASGNVSIATDMLMRDFMFGEAGSALTVHFLRNKPK---PSINLESWES 273

  Fly   257 ELSTKQNC------AVVVQKPSRLHCRYNTTTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEID 315
            :.|..|.|      .:...|||||||||||.||||.::||.:||||.||||::.:|:|:.|.||:
  Fly   274 DESFNQLCRSSSRRQMGESKPSRLHCRYNTITTPFLKLAPFRMEELSLDPYVIFYHNVLSDAEIE 338

  Fly   316 GM-------LNSSNFGLSLTDSGQKSEVRTSKDSYIV-------DAKTLN---ERVTDMTGFSME 363
            .:       |..:........|.:....|::..:::.       |.:.||   .|:.||||.:..
  Fly   339 KLKPMGKPFLERAKVFRVEKGSDEIDPSRSADGAWLPHQNIDPDDLEVLNRIGRRIEDMTGLNTR 403

  Fly   364 MSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQGDRIATVLFYLGEVDSGGATIFPMINITVTPK 428
            .......:.||.|||::.|||:......:....|||||||||||..||.||||:||.:|:.|..:
  Fly   404 SGSKMQFLKYGFGGHFVPHYDYFNSKTFSLETVGDRIATVLFYLNNVDHGGATVFPKLNLAVPTQ 468

  Fly   429 KGSAVFWYNL-HNSGAMNLKSLHSACPVISGSKYVLTKWINELPQMFVTPCMKDSNLHPPQ 488
            ||||:||:|: ..|...:.::.|.|||:|||:|.|:|:||.||.|||:.|.:.     ||:
  Fly   469 KGSALFWHNIDRKSYDYDTRTFHGACPLISGTKLVMTRWIYELDQMFLIPAVL-----PPR 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 41/134 (31%)
metallo-dependent_hydrolases <237..>306 CDD:294200 34/76 (45%)
P4Hc 313..467 CDD:214780 61/172 (35%)
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528 41/134 (31%)
P4Hc 333..508 CDD:214780 62/175 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146331204
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.