DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and P4ha3

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_011240133.1 Gene:P4ha3 MGIID:2444049 Length:575 Species:Mus musculus

Alignment Length:489 Identity:123/490 (25%)
Similarity:202/490 (41%) Gaps:127/490 (26%)


  Fly    31 SYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSR---ENMEMKSDYESYLGNP 92
            :::|.| .:.:.|..|..|:..|:.|::.       .|..|.|::|   :.:.:..|.:..:.||
Mouse    28 TFSALT-SVARALAPERRLLGTLRRYLRG-------EEARLRDLTRFYDKVLSLHEDLKIPVVNP 84

  Fly    93 LNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLMR-------KMLPTSSDLQQACRGIHDL 150
            |.:|.||.||.:.||...        ::|...||.|.::       :.||...||:.|.|.:..|
Mouse    85 LLAFTLIKRLQSDWRNVV--------HSLEATENIRALKDGYEKVEQDLPAFEDLEGAARALMRL 141

  Fly   151 MSFYDLKPEELAAGNLAGYSQPGTG--------------LTAYDCLALGEFSVQKREDDLAEAWY 201
            ...|.|..:.||    .|..|..||              |||.||..:|:.:....:...|..|.
Mouse   142 QDVYMLNVKGLA----RGVFQRVTGSSITDLYSPRQLFSLTADDCFQVGKVAYDTGDYYHAIPWL 202

  Fly   202 N--LSLIRFENKFDKYRVHKAWGLLLAKNKQLTDAF-------------------------YHFE 239
            .  :||.|        |.|..|  .......|.||.                         |..:
Mouse   203 EEAVSLFR--------RAHGEW--KTEDEASLEDALDYLAFACFQVGNVSCALSLSREFLVYSPD 257

  Fly   240 NKP--------EGIIASN-------------EVIHFKEELSTKQNCAVVVQKPSR-----LHCRY 278
            ||.        |.::|.|             .|.|.:...:.:..|..:..:|:.     |:|.|
Mouse   258 NKRMARNVLKYERLLAENGHQMAAETAIQRPNVPHLQTRDTYEGLCQTLGSQPTHYQIPSLYCSY 322

  Fly   279 NTTTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGL--SLTDSGQKS---EVRT 338
            .|.::|:..:.|.:.|.:.|.|.:.::||.:.|.|...:...:...|  |:..||:|.   |.|.
Mouse   323 ETNSSPYLLLQPARKEVVHLRPLIALYHDFVSDEEAQKIRELAEPWLQRSVVASGEKQLQVEYRI 387

  Fly   339 SKDSYIVDA-----KTLNERVTDMTGFSMEMSDPFS----LINYGLGGHYMLHYDFHEYTNTT-- 392
            ||.:::.|.     .||:.|:..:||  :::..|::    ::|||:||||..|:| |..:.::  
Mouse   388 SKSAWLKDTVDPMLVTLDHRIAALTG--LDIQPPYAEYLQVVNYGIGGHYEPHFD-HATSPSSPL 449

  Fly   393 -RPKQGDRIATVLFYLGEVDSGGATIFPMINITV 425
             |.|.|:|:||.:.||..|::||||.|...|.:|
Mouse   450 YRMKSGNRVATFMIYLSSVEAGGATAFIYGNFSV 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 36/141 (26%)
metallo-dependent_hydrolases <237..>306 CDD:294200 18/95 (19%)
P4Hc 313..467 CDD:214780 43/131 (33%)
P4ha3XP_011240133.1 P4Ha_N 31..157 CDD:285528 38/146 (26%)
P4Hc 354..>476 CDD:214780 41/125 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92169389
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.851 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.