DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and CG31524

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_733379.2 Gene:CG31524 FlyBaseID:FBgn0051524 Length:536 Species:Drosophila melanogaster

Alignment Length:537 Identity:166/538 (31%)
Similarity:269/538 (50%) Gaps:74/538 (14%)


  Fly     1 MYILKNL-TLIGFLSACFINCQGFVKSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKF 64
            |.:||.| .:|.|||.    ..|.:::...: :|.|.:.:..||.:||:||..|:||.:.|..|.
  Fly     1 MPVLKLLFVVIFFLSL----SMGQIEATQPR-FARSVVNMDDLLNMEDDLVSKLEGYAEKLSYKA 60

  Fly    65 NLMERSLIDMSRENMEMKSDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIK-VENNALGH--IEN 126
            |.: |..|...||.::.....:|:  :..|.:..|..:...|..|.||..| |..:.|.:  ::|
  Fly    61 NTI-RWGIQQMREQLDKSKKEQSF--DLFNRYSFIRHMQADWLMWKQYLDKPVIRDELNYKQMDN 122

  Fly   127 ARLMRKMLPTSSDLQQACRGIHDLMSFYDLKPEELAAGNLAGYSQPGTGLTAYDCLALGEFSVQK 191
            .|     :|...||..|...|..:.:.|.:...::|.|.|.|. |..:.|:..||||:|...:.:
  Fly   123 LR-----MPQELDLFDASEAIRRMQATYAMLSNDIAEGFLDGV-QYTSKLSPIDCLAMGRHLMNQ 181

  Fly   192 REDDLAEAWY-----------------------------NLSLIRFENKFDKYRVHKAWGLLLAK 227
            ....:||.|.                             .|..:|||.:.::..: ||:...|..
  Fly   182 SRWTIAEQWILAGIKAQDRKGPQTEMILLRGPTKAELFRTLGKVRFERRNEEGAL-KAYQAALKH 245

  Fly   228 NKQLTDAFYHFENKPEGI--IASNEVIHFK-----EELSTKQNCAVVVQKP---SRLHCRYNTTT 282
            :....:.|..::|....:  ::.:|.|..:     ||:.....|:...:.|   :||:|.||..|
  Fly   246 SPHDLEIFQEYQNLKRRVLTLSPSEPIREEPNDDIEEMELPPCCSGRCEGPRKLNRLYCVYNCVT 310

  Fly   283 TPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGLSL----TDSGQKSEV---RTSK 340
            .||.|:||:|.|.|.:||::::.||::...| ..::.||:....|    .::..:.|:   ||||
  Fly   311 APFLRLAPIKTEILSVDPFVILLHDMVSHKE-GALIRSSSKNQILPSETVNAANEFEIAKFRTSK 374

  Fly   341 ----DSYIVDAK-TLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQG--D 398
                ||...:|. .|.:|:.:.||..|:.|:||.:||||:||.:..|:| ....:..|...|  |
  Fly   375 SVWFDSDANEATLKLTQRLGEATGLDMKHSEPFQVINYGIGGVFESHFD-TSLADEDRFVNGYID 438

  Fly   399 RIATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVL 463
            |:||.||||.:|..||||.||.:||||.||.|:.:.|||||..|.::::::|:.||||.|||:|:
  Fly   439 RLATTLFYLNDVPQGGATHFPGLNITVFPKFGTVLMWYNLHTEGMLHVRTMHTGCPVIVGSKWVV 503

  Fly   464 TKWINELPQMFVTPCMK 480
            :|||::..|.|..||::
  Fly   504 SKWIDDKGQEFRRPCLR 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 37/134 (28%)
metallo-dependent_hydrolases <237..>306 CDD:294200 23/79 (29%)
P4Hc 313..467 CDD:214780 69/168 (41%)
CG31524NP_733379.2 P4Ha_N 31..157 CDD:285528 37/134 (28%)
TPR_11 215..>259 CDD:290150 9/45 (20%)
TPR_2 216..249 CDD:285020 7/34 (21%)
P4Hc 340..507 CDD:214780 69/169 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146326940
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.