DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and CG32201

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_730346.2 Gene:CG32201 FlyBaseID:FBgn0052201 Length:520 Species:Drosophila melanogaster

Alignment Length:523 Identity:171/524 (33%)
Similarity:267/524 (51%) Gaps:68/524 (13%)


  Fly     9 LIGF-LSACFINCQGFVKSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLI 72
            |:|| :...|:.|...::.  |:.|::||:.|:|||:||::..|||...|..|..||..:...|.
  Fly    11 LLGFAVLNSFVGCVEDIEE--KERYSSSTVGLLKLLKVEEKFTDNLLNQVDQLGEKFEALRMYLS 73

  Fly    73 DMSRENMEMKSDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARL--MRKMLP 135
            .:..|.....::...|:.||:|:|.|:.|.|....||::|.    ..|:|....:.|  :.||:|
  Fly    74 SVGYELHRSLNEKVQYVSNPINAFSLLRRTHEDLPKWHEYF----KEAIGEGNQSILVDLVKMVP 134

  Fly   136 TSSDLQQACRGIHDLMSFYDLKPEELAAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDLAEAW 200
            ...|:..|..||..:...||||.::||.|.|.|. |....||..|.:|:|....|:.:...|..|
  Fly   135 NDVDMLSAMHGIQRIEKIYDLKIDDLAQGVLQGV-QYNVQLTYRDLIAMGNSMYQQSDYQTAAKW 198

  Fly   201 YNLSLIR-FENKFDKY---------RVHKAWGLLLAK--------NKQLTDAFYHFENKPEGIIA 247
            |.::..| .||....:         .:|:.:...|.|        :|.:.:||...:...|    
  Fly   199 YRIACKRELENPEQLFIQILGDPSEHLHRQYIKSLFKYGSTTSEPSKSIEEAFIMVQASQE---- 259

  Fly   248 SNEVIHFKEELSTKQN---------------------CAVVVQKPSRLHCRYNTTTTPFTRIAPL 291
              |:.:...:|:..||                     |..:.::.:.|.|||.:|...|.|:|||
  Fly   260 --ELDNIMSDLNEPQNDVEVEKDLYQVKRSPSNCELGCRGLYRQKTNLVCRYKSTANTFLRLAPL 322

  Fly   292 KMEELGLDPYMVVFHDVIYDTEIDGMLNSS-NFGLSLTDSGQKSEVRTSKDSYIVDAKT------ 349
            |:||:.|||:|.::|:|:||:||..:...| |...........:|:|.:...|...:.|      
  Fly   323 KLEEISLDPFMAMYHEVLYDSEIRELKGQSMNMVNGYASQRNGTEIRDTVVRYDWWSNTSLVRER 387

  Fly   350 LNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDF----HEYTNTTRPKQGDRIATVLFYLGEV 410
            :|:|:.|||||:....:...:.|||||.::..|:|:    .|..|.|  ..|||:|::|||..||
  Fly   388 INQRIIDMTGFNFLKDEKLQIANYGLGTYFQPHFDYSSDGFETPNIT--TLGDRLASILFYASEV 450

  Fly   411 DSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWINELPQMFV 475
            ..||||:||.||:||.|:|||.::|:|||:.|..:::||||.|||::|.::.||||:...||||.
  Fly   451 PQGGATVFPEINVTVFPQKGSMLYWFNLHDDGKPDIRSLHSVCPVLNGDRWTLTKWVPMFPQMFS 515

  Fly   476 TPC 478
            .||
  Fly   516 FPC 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 45/133 (34%)
metallo-dependent_hydrolases <237..>306 CDD:294200 23/90 (26%)
P4Hc 313..467 CDD:214780 65/165 (39%)
CG32201NP_730346.2 P4Ha_N 36..165 CDD:285528 45/133 (34%)
P4Hc 341..507 CDD:214780 67/168 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146326074
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.