DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and P4htm

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_001075237.3 Gene:P4htm RGDID:1311848 Length:553 Species:Rattus norvegicus

Alignment Length:226 Identity:65/227 (29%)
Similarity:96/227 (42%) Gaps:65/227 (29%)


  Fly   311 DTEIDGMLNSSNF-GLSLTD--------SGQKSE-VRTSKDSYIVDA-------KTLNERVTDMT 358
            |.:.||:|:...| .:.|.|        ..:.|| ||.|..:::...       :.:.:||..:|
  Rat   288 DPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLHQGEGAHHVMRAIRQRVLRLT 352

  Fly   359 GFS---MEMSDPFSLINYGLGGHYMLHYD----FHE--------YTNTTRP-KQGDRIATVLFYL 407
            ..|   :|:|:|..::.||.||||..|.|    :.|        ..|.:.| :...|..||||||
  Rat   353 RLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETVCSHTKLVANESVPFETSCRYMTVLFYL 417

  Fly   408 GEVDSGGATIFPMI---------------------------NITVTPKKGSAVFWYNLHNS---- 441
            ..|..||.|:||:.                           |:.|.|::|:||||||....    
  Rat   418 NNVTGGGETVFPVADNRTYDEMSLIQDNVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGW 482

  Fly   442 -GAMNLKSLHSACPVISGSKYVLTKWINELP 471
             |.::..|||..|.|..|:|::...|||..|
  Rat   483 VGEVDDYSLHGGCLVTRGTKWIANNWINVDP 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200
P4Hc 313..467 CDD:214780 61/219 (28%)
P4htmXP_001075237.3 EF-hand_7 243..303 CDD:290234 5/15 (33%)
EFh 245..303 CDD:298682 5/15 (33%)
P4Hc 297..509 CDD:214780 58/212 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92090826
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.