DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and P4HA3

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001275677.1 Gene:P4HA3 HGNCID:30135 Length:604 Species:Homo sapiens

Alignment Length:548 Identity:128/549 (23%)
Similarity:228/549 (42%) Gaps:125/549 (23%)


  Fly    27 NPKKSYA-----ASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSR---ENMEMKS 83
            :|:::.|     ::...:.:.|..|..|:..|:.|::.       .|..|.|::|   :.:.:..
Human    20 DPERAAARGDTFSALTSVARALAPERRLLGLLRRYLRG-------EEARLRDLTRFYDKVLSLHE 77

  Fly    84 DYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKMLPTSSDLQQACRGIH 148
            |..:.:.|||.:|.||.||.:.||. ..::::...|.....:....:.:.||...||:.|.|.:.
Human    78 DSTTPVANPLLAFTLIKRLQSDWRN-VVHSLEASENIRALKDGYEKVEQDLPAFEDLEGAARALM 141

  Fly   149 DLMSFYDLKPEELAAGNLAGYSQPGTG--------------LTAYDCLALGEFSVQKREDDLAEA 199
            .|...|.|..:.||    .|..|..||              ||..||..:|:.:....:...|..
Human   142 RLQDVYMLNVKGLA----RGVFQRVTGSAITDLYSPKRLFSLTGDDCFQVGKVAYDMGDYYHAIP 202

  Fly   200 WYNLSLIRFENKFDKYRV-----------HKAWGLLLAKN----KQLTDAFYHFENKPEGIIASN 249
            |...::..|...:.:::.           |.|:....|.|    ..|:..|..:  .|:....:.
Human   203 WLEEAVSLFRGSYGEWKTEDEASLEDALDHLAFAYFRAGNVSCALSLSREFLLY--SPDNKRMAR 265

  Fly   250 EVIHFKEELSTKQNCAV---VVQKPS---------------------------RLHCRYNTTTTP 284
            .|:.::..|:...|..|   |:|:|:                           .|:|.|.|.:..
Human   266 NVLKYERLLAESPNHVVAEAVIQRPNIPHLQTRDTYEGLCQTLGSQPTLYQIPSLYCSYETNSNA 330

  Fly   285 FTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGL--SLTDSGQKS---EVRTSKDSYI 344
            :..:.|::.|.:.|:||:.::||.:.|:|...:...:...|  |:..||:|.   |.|.||.:::
Human   331 YLLLQPIRKEVIHLEPYIALYHDFVSDSEAQKIRELAEPWLQRSVVASGEKQLQVEYRISKSAWL 395

  Fly   345 ---VDAK--TLNERVTDMTGFSMEMSDPFS----LINYGLGGHYMLHYDFHEYTNTT---RPKQG 397
               ||.|  |||.|:..:||  :::..|::    ::|||:||||..|:| |..:.::   |.|.|
Human   396 KDTVDPKLVTLNHRIAALTG--LDVRPPYAEYLQVVNYGIGGHYEPHFD-HATSPSSPLYRMKSG 457

  Fly   398 DRIATVLFYLGEVDSGGATIFPMINI-------------------TVTPKKGSAVFWYNLH---N 440
            :|:||.:.||..|::||||.|...|:                   |||....:.:.|:.:.   .
Human   458 NRVATFMIYLSSVEAGGATAFIYANLSVPVVRHCFGGTCTGVVKGTVTHFMLAVLSWWEISGWPT 522

  Fly   441 SGAMNL--KSLHSACPVISGSKYVLTKW 466
            ||.|::  .|...|.|.:.........|
Human   523 SGYMSMDRNSADPAAPALKTELLAERSW 550

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 32/134 (24%)
metallo-dependent_hydrolases <237..>306 CDD:294200 17/99 (17%)
P4Hc 313..467 CDD:214780 56/196 (29%)
P4HA3NP_001275677.1 P4Ha_N 58..159 CDD:285528 28/106 (26%)
TPR_12 186..252 CDD:290160 9/66 (14%)
P4Hc 356..>478 CDD:214780 44/125 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92171904
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.851 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.