DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and phy-4

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001123049.1 Gene:phy-4 WormBaseID:WBGene00012815 Length:282 Species:Caenorhabditis elegans

Alignment Length:245 Identity:64/246 (26%)
Similarity:122/246 (50%) Gaps:34/246 (14%)


  Fly   248 SNEVIHFKEELSTKQNCAVVVQ----KPSRLHCRYNTTTTPFTRIAPLKMEELGLDPYMVVFHDV 308
            ::|.:.|.:::..|  |...::    :..||.| |........|    |:|.|..:|:::.:|:.
 Worm    22 TDETLEFNDKIWDK--CGKELRGDSSRDGRLVC-YRLHKHLLIR----KVEILSSEPFILQYHNQ 79

  Fly   309 IYD-------TEIDGM----LNSSNFGLSLTDSGQKSEVRTSKDSYIVD------AKTLNERVTD 356
            ::.       .|.:.:    |..|.|    |.:.:||:||.:..::::.      |:.......:
 Worm    80 VHRRLAKRAVQEAEALRLEQLKISGF----TTTPEKSQVRAANGTWLIHTGRPSFARIFEGLQAN 140

  Fly   357 MTGFSMEMSDPFSLINYGLGGHYMLHYDF-HEYTNTTRPK-QGDRIATVLFYLGEVDSGGATIFP 419
            :....:..::|:.:::|...|:|..|||: :..||....: :|:||||||..|.....||.|:||
 Worm   141 INSLDLSTAEPWQILSYNADGYYAPHYDYLNPATNVQLVEGRGNRIATVLVILQIAKKGGTTVFP 205

  Fly   420 MINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWINE 469
            .:|:.:.||.|..:.|.|..::|..|.::||:|||:..|:|...|.|::|
 Worm   206 RLNLNIRPKAGDVIVWLNTLSTGESNSQTLHAACPIHEGTKIGATLWVHE 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 13/62 (21%)
P4Hc 313..467 CDD:214780 49/166 (30%)
phy-4NP_001123049.1 P4Hc 81..254 CDD:214780 49/177 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.960

Return to query results.
Submit another query.