DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and P4ha2

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_006532515.1 Gene:P4ha2 MGIID:894286 Length:557 Species:Mus musculus

Alignment Length:534 Identity:143/535 (27%)
Similarity:242/535 (45%) Gaps:94/535 (18%)


  Fly    32 YAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPLNSF 96
            :..|...:..|:..|.:||.:||.|:...:.|...::.....|........:|.|.||.:|:|::
Mouse    25 FFTSIGHMTDLIYAEKDLVQSLKEYILVEEAKLAKIKSWASKMEALTSRSAADPEGYLAHPVNAY 89

  Fly    97 RLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKMLPTSSDLQQACRGIHDLMSFYDLKPEEL 161
            :|:.||:|.|.....  :.:::.:.|.:.|..:.|:..||..|...|.|.:..|...|.|.|:.:
Mouse    90 KLVKRLNTDWPALGD--LVLQDASAGFVANLSVQRQFFPTDEDESGAARALMRLQDTYKLDPDTI 152

  Fly   162 AAGNLAGYSQPGTG----LTAYDCLALGEFS---------------VQKREDDLAEAWYNLSLIR 207
            :.|.|     |||.    |:..||..||..:               |.|:.|...||....||:.
Mouse   153 SRGEL-----PGTKYQAMLSVDDCFGLGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATVTKSLVL 212

  Fly   208 FENKFDKYR---VHKAWGL---LLA---KNKQLTDAFYHFE------------NKPEGIIASNEV 251
            ....:..::   :|:|..|   ||:   .:::......:||            |:.:..:|:.|.
Mouse   213 DYLSYAVFQLGDLHRAVELTRRLLSLDPSHERAGGNLRYFERLLEEERGKSLSNQTDAGLATQEN 277

  Fly   252 IHFK-----------EELSTKQNCAVVVQKPSRLHCRY-NTTTTPFTRIAPLKMEELGLDPYMVV 304
            ::.:           |.|...:...:..::..:|.||| :....|...|||.|.|:....|::|.
Mouse   278 LYERPTDYLPERDVYESLCRGEGVKLTPRRQKKLFCRYHHGNRVPQLLIAPFKEEDEWDSPHIVR 342

  Fly   305 FHDVIYDTEIDGMLNSSNFGLS-LTDSGQKSEV------RTSKDSYIVD-----AKTLNERVTDM 357
            ::||:.|.||:.:...:...|: .|....|:.|      |.||.|::.:     ...:|.|:..:
Mouse   343 YYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHI 407

  Fly   358 TGFSMEMSDPFSLINYGLGGHYMLHYDF-----------------------HEYTNTTRPKQGDR 399
            ||.:::.::...:.|||:||.|..|:||                       .|.....|...|:|
Mouse   408 TGLTVKTAELLQVANYGMGGQYEPHFDFSRRPFDSGLKTEGNRLATFLNYSDEQDAFKRLGTGNR 472

  Fly   400 IATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLT 464
            :||.|.|:.:|::||||:||.:...:.||||:|||||||..||..:.::.|:||||:.|.|:|..
Mouse   473 VATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRSGEGDYRTRHAACPVLVGCKWVSN 537

  Fly   465 KWINELPQMFVTPC 478
            ||.:|..|.|:.||
Mouse   538 KWFHERGQEFLRPC 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 34/131 (26%)
metallo-dependent_hydrolases <237..>306 CDD:294200 19/93 (20%)
P4Hc 313..467 CDD:214780 61/189 (32%)
P4ha2XP_006532515.1 P4Ha_N 28..157 CDD:285528 34/131 (26%)
P4Hc 348..541 CDD:214780 62/193 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.