DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and P4ha1

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001303300.1 Gene:P4ha1 MGIID:97463 Length:534 Species:Mus musculus

Alignment Length:518 Identity:147/519 (28%)
Similarity:242/519 (47%) Gaps:81/519 (16%)


  Fly    32 YAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPLNSF 96
            :..|..::..|:..|.:||.:||.|:|..:.|...:::....:.|.......|.|.::|:|:|:|
Mouse    21 FFTSIGQMTDLIHNEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAF 85

  Fly    97 RLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKMLPTSSDLQQACRGIHDLMSFYDLKPEEL 161
            :|:.||:|.|.:.....:|..::  |.|.|..:.|:..|...|...|.:.:..|...|:|....:
Mouse    86 KLMKRLNTEWSELENLILKDMSD--GFISNLTIQRQYFPNDEDQVGAAKALFRLQDTYNLDTNTI 148

  Fly   162 AAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDLAEAWYNLSLIRFE----NKFDK-------- 214
            :.|||.|. |..:.|||.||..||:.:..:.:....|.|...:|.:.|    :..||        
Mouse   149 SKGNLPGV-QHKSFLTAEDCFELGKVAYTEADYYHTELWMEQALTQLEEGELSTVDKVSVLDYLS 212

  Fly   215 YRVHKAWGL---LLAKNKQLTDAFYHFENKPEGIIASNEVIHFK--------------------- 255
            |.|::...|   ||...|.|       |..||...|:..:::|:                     
Mouse   213 YAVYQQGDLDKALLLTKKLL-------ELDPEHQRANGNLVYFEYIMSKEKDANKSASGDQSDQK 270

  Fly   256 -------------------EELSTKQNCAVVVQKPSRLHCRYNT-TTTPFTRIAPLKMEELGLDP 300
                               |.|...:...:..::..||.|||:. ...|...:||.|.|:....|
Mouse   271 TAPKKKGIAVDYLPERQKYEMLCRGEGIKMTPRRQKRLFCRYHDGNRNPKFILAPAKQEDEWDKP 335

  Fly   301 YMVVFHDVIYDTEIDGMLNSSNFGLSLT-----DSGQ--KSEVRTSKDSYIVD-----AKTLNER 353
            .::.|||:|.|.||:.:.:.:...||..     ::|:  .::.|.||.:::..     ...:|.|
Mouse   336 RIIRFHDIISDAEIEIVKDLAKPRLSRATVHDPETGKLTTAQYRVSKSAWLSGYEDPVVSRINMR 400

  Fly   354 VTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQ---GDRIATVLFYLGEVDSGGA 415
            :.|:||..:..::...:.|||:||.|..|:||.........::   |:||||.|||:.:|.:|||
Mouse   401 IQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFRELGTGNRIATWLFYMSDVSAGGA 465

  Fly   416 TIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWINELPQMFVTPC 478
            |:||.:..:|.||||:|||||||..||..:..:.|:||||:.|:|:|..||::|..|.|..||
Mouse   466 TVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPC 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 35/131 (27%)
metallo-dependent_hydrolases <237..>306 CDD:294200 19/110 (17%)
P4Hc 313..467 CDD:214780 61/169 (36%)
P4ha1NP_001303300.1 P4Ha_N 24..153 CDD:285528 35/131 (27%)
TPR 205..238 10/40 (25%)
P4Hc 345..518 CDD:214780 62/173 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.