DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and C14E2.4

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_508333.2 Gene:C14E2.4 WormBaseID:WBGene00015773 Length:310 Species:Caenorhabditis elegans

Alignment Length:196 Identity:54/197 (27%)
Similarity:87/197 (44%) Gaps:21/197 (11%)


  Fly   291 LKMEELGLDPYMVVFHDVIYDTEIDGMLN-----SSNFGLSLTDSG--------QKSEVRTSKDS 342
            ::||.|...|.:|::.||....::...|.     ..|....:.|.|        |.:...|...|
 Worm    81 VRMEILSWSPPLVIYRDVFSKKQVSDYLELLKNLKMNEQKVVRDDGEIAYSTYRQANGTITPAHS 145

  Fly   343 YIVDAKTLNERVTDMTG-FSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRP-----KQGDRIA 401
            : .:|::|.:..|.:.. |..:.::..|.::|..||||.||.||..:.|....     :.|:|:|
 Worm   146 H-AEAQSLMDTATQLLPVFDFQYTEQISALSYIKGGHYALHTDFLTFANAEDSNRHFGEMGNRLA 209

  Fly   402 TVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKW 466
            |.:....:.:.||.|:||.:........|.|..|:|. |......||||..||:.:|.|.:.|.|
 Worm   210 TFIMVFKKAEKGGGTLFPQLGNVFRANPGDAFLWFNC-NGNLEEAKSLHGGCPIRAGEKIIATIW 273

  Fly   467 I 467
            |
 Worm   274 I 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 5/15 (33%)
P4Hc 313..467 CDD:214780 46/173 (27%)
C14E2.4NP_508333.2 P4Hc 100..275 CDD:214780 47/178 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.960

Return to query results.
Submit another query.