DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and dpy-18

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_499464.1 Gene:dpy-18 WormBaseID:WBGene00001077 Length:559 Species:Caenorhabditis elegans

Alignment Length:519 Identity:140/520 (27%)
Similarity:235/520 (45%) Gaps:82/520 (16%)


  Fly    35 STMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPLNSFRLI 99
            |..::..|||.|..:...|..|:...:.:...:::...:.|::|.....:....:.||:|:|.||
 Worm    21 SIADMQNLLETERNIPKILDKYIHDEEERLVQLKKLSEEYSKKNEISIENGLKDITNPINAFLLI 85

  Fly   100 HRLHTSWRKWYQYAIKVENNALGHI-----ENARLMRKMLPTSSDLQQACRGIHDLMSFYDLKPE 159
            .|....|:   :...|:..|..|::     :::..:|  .||:.||..|..|:..|...|.|..:
 Worm    86 KRKIFDWK---EIESKMNANKAGNVVSSITDDSYGVR--YPTADDLSGAAIGLLRLQDTYRLDTK 145

  Fly   160 ELAAGNLAGYSQPGT-GLTAYDCLALGEFS---------------VQKREDD------------- 195
            :||.|.:  |:..|. ..:|.||..:...:               .|:|..|             
 Worm   146 DLADGKI--YADQGNYTFSAKDCFEIARAAYNEHDFYHTVMWMEEAQRRLGDEVEPTVEVEDILE 208

  Fly   196 -LAEAWYNLSLIRFENKF--DKYRVHKA---------W--GLLLAKNKQLTDAFYHF----ENKP 242
             ||.|.|..:.::...|.  :.|:::..         |  .||..:..:.:|...:.    ..:|
 Worm   209 YLAFALYKQNNLKHALKLTEELYKMNPTHPRAKGNVKWYEDLLEQEGVRRSDMRKNLPPIQNRRP 273

  Fly   243 EGIIASNEVIHFKEELSTKQNCAVVVQKP-SRLHCRYNTTTTPFTRIAPLKMEELGLDPYMVVFH 306
            :.::.:.|...::   :..:|...|.||. |||:|.|. ...||...||:|:|....:|..|:|.
 Worm   274 DSVLGNTERTMYE---ALCRNEVPVSQKDISRLYCYYK-RDRPFLVYAPIKVEIKRFNPLAVLFK 334

  Fly   307 DVIYDTEIDGM-------LNSSNFGLSLTDSGQKSEVRTSKDSYIVD-----AKTLNERVTDMTG 359
            |||.|.|:..:       |..:....|:|.....:..|.||.:::.:     .:|:|:|:..||.
 Worm   335 DVISDDEVAAIQELAKPKLARATVHDSVTGKLVTATYRISKSAWLKEWEGDVVETVNKRIGYMTN 399

  Fly   360 FSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQ----GDRIATVLFYLGEVDSGGATIFPM 420
            ..||.::...:.|||:||||..|:| |.....::..:    |:||||||||:.:...||.|:|..
 Worm   400 LEMETAEELQIANYGIGGHYDPHFD-HAKKEESKSFESLGTGNRIATVLFYMSQPSHGGGTVFTE 463

  Fly   421 INITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWINELPQMFVTPC-MKDSN 483
            ...|:.|.|..|:|||||:..|..|..:.|:||||:.|.|:|..|||:|....|..|| :|.|:
 Worm   464 AKSTILPTKNDALFWYNLYKQGDGNPDTRHAACPVLVGIKWVSNKWIHEKGNEFRRPCGLKSSD 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 33/136 (24%)
metallo-dependent_hydrolases <237..>306 CDD:294200 20/74 (27%)
P4Hc 313..467 CDD:214780 58/170 (34%)
dpy-18NP_499464.1 P4Ha_N 21..152 CDD:285528 33/136 (24%)
P4Hc 338..511 CDD:214780 60/174 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.