DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and LOC110438249

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_021324927.1 Gene:LOC110438249 / 110438249 -ID:- Length:229 Species:Danio rerio


Alignment Length:225 Identity:79/225 - (35%)
Similarity:125/225 - (55%) Gaps:20/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 QKPSRLHCRYNTTTTPFTRIAPLKM--EELGLD-PYMVVFHDVIYDTEIDGMLNSSNFGLSLTD- 329
            |:..:|.|||..     .|..||.:  ||:..| |.::.:||.:.:.|||.:...:...||... 
Zfish     4 QRERKLVCRYRR-----GRGNPLMLFKEEVEWDQPMILRYHDFLSEGEIDTIKTLARPKLSRAQV 63

  Fly   330 ----SGQK--SEVRTSKDSYIVD-----AKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHY 383
                ||::  :..|.|:.:::.:     ...:|:|:.|:||..::.::...:.|||:||.|..||
Zfish    64 IDAVSGKRVSAASRVSQSAWLYEDEDPVVTQVNQRIADVTGLELQTAESLQIANYGIGGQYEPHY 128

  Fly   384 DFHEYTNTTRPKQGDRIATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKS 448
            |.....::....:|.||||||.|:.:||.||||:||.:...:.||:||||.|:||..:|..::::
Zfish   129 DSKLTNDSDFQLRGGRIATVLIYMSDVDIGGATVFPDVGAALQPKRGSAVLWFNLLRNGNEDIRT 193

  Fly   449 LHSACPVISGSKYVLTKWINELPQMFVTPC 478
            ||:||||..|||:|..|||....|.|...|
Zfish   194 LHAACPVFVGSKWVANKWIRTYGQEFRRKC 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 12/39 (31%)
P4Hc 313..467 CDD:214780 60/165 (36%)
LOC110438249XP_021324927.1 PLN00052 28..218 CDD:177683 66/189 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.