DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and LOC101734880

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_004920577.2 Gene:LOC101734880 ID: Length:164 Species:Xenopus tropicalis

Alignment Length:137 Identity:39/138 (28%)
Similarity:73/138 (53%) Gaps:3/138 (2%)


  Fly    35 STMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESYLGNPLNSFRLI 99
            ||.::..|:..|.:|:.:||.|::..:.:.:.::|...::...:....:|.|.|||:|:|:::|:
 Frog    26 STGQMTDLIFRERDLLQSLKEYIREEEERLSKIKRWASEVDELSSRSTADPEGYLGHPVNAYKLV 90

  Fly   100 HRLHTSWRKWYQYAIKVENNALGHIENARLMRKMLPTSSDLQQACRGIHDLMSFYDLKPEELAAG 164
            .|.:|.|.....  :.::::|.|.|.|....|:..||..|...|.|.:..:...|.|.|:.:|.|
 Frog    91 KRFNTDWSSLEN--LVLQDSAKGFIANFTFQREYFPTEEDETGAARALMRIQDTYKLDPDVIAKG 153

  Fly   165 NLAG-YS 170
            .|.| ||
 Frog   154 KLPGQYS 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 35/131 (27%)
metallo-dependent_hydrolases <237..>306 CDD:294200
P4Hc 313..467 CDD:214780
LOC101734880XP_004920577.2 P4Ha_N 26..155 CDD:285528 35/131 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.