DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and LOC100492280

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_002936013.2 Gene:LOC100492280 ID: Length:530 Species:Xenopus tropicalis

Alignment Length:543 Identity:160/544 (29%)
Similarity:245/544 (45%) Gaps:96/544 (18%)


  Fly     7 LTLIGFLSACFINCQGFVKSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSL 71
            |.|:|..|....:            :..|...:..||..|.:||.:||.|:|..:.|...:::..
 Frog     7 LPLLGLFSCAHAD------------FFTSIGHMTDLLNTEKDLVTSLKDYIKAEEQKLAQIKKWA 59

  Fly    72 IDMSRENMEMKSDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNAL-----GHIENARLMR 131
            ..:.........|.|.:||:|:|:|:|:.||:|.|       :|:||..|     |.|.|..:.|
 Frog    60 DKLDHLTDTATKDPEGFLGHPVNAFKLMKRLNTEW-------VKLENLILKDISDGFISNLTIQR 117

  Fly   132 KMLPTSSDLQQACRGIHDLMSFYDLKPEELAAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDL 196
            :..|...|...|.:.:..|...|:|..:.::.|||.|.... |.|||.||..||:.:....:...
 Frog   118 QYFPNDEDQTGAAKALLRLQDTYNLDTDTISKGNLPGVKHK-TSLTAEDCFDLGKTAYTDADYYH 181

  Fly   197 AEAWYNLSLIRF----ENKFDK--------YRVHKAWGLLLAKNKQLTDAFYHFENKPE-----G 244
            .|.|...:|.:.    |:..||        |.|::...|    :|.||......|..||     |
 Frog   182 TELWMEQALSQLDAGEESSLDKVMVLDYLSYAVYQQGDL----DKALTLTKLLLELDPEHQRGNG 242

  Fly   245 IIASNEVIHFKE------------ELSTK--------------------QNCAVVVQKPSRLHCR 277
            .:...|.|..||            ||.|:                    :...:..::..||.||
 Frog   243 NLRYFEYIMSKESNKSSSSPSEGAELGTRKGRPKDHLPERQKYEKLCRGEGVKMTSRRQKRLFCR 307

  Fly   278 Y-NTTTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGM-------LNSSNFGLSLTDSGQKS 334
            | :....|...::|.|.|:....|.:|.:||:|.|.||..:       |..:.....:|...:.:
 Frog   308 YFDGNKDPLLILSPTKQEDEWDKPRIVRYHDIISDEEISKVKELAKPRLRRATISNPITGVLETA 372

  Fly   335 EVRTSKDSYI------VDAKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTR 393
            :.|.||.:::      |.|: ||.|:..:||..|..::...:.|||:||.|..|:||........
 Frog   373 QYRISKSAWLSAYEDPVVAR-LNRRIEGVTGLDMSTAEELQVANYGMGGQYEPHFDFARKDEPDA 436

  Fly   394 PKQ---GDRIATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPV 455
            .|:   |:|:||.|||:.:|::||||:||.:...|.||||:|||||||..||..:..:.|:||||
 Frog   437 FKELGTGNRVATWLFYMSDVEAGGATVFPEVGAAVYPKKGTAVFWYNLFESGEGDYSTRHAACPV 501

  Fly   456 ISGSKYVLTKWINELPQMFVTPC 478
            :.|:|:|..|||:|..|.|..||
 Frog   502 LVGNKWVSNKWIHERGQEFRRPC 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 39/136 (29%)
metallo-dependent_hydrolases <237..>306 CDD:294200 22/107 (21%)
P4Hc 313..467 CDD:214780 63/170 (37%)
LOC100492280XP_002936013.2 P4Ha_N 23..152 CDD:285528 39/136 (29%)
P4Hc 341..514 CDD:214780 65/174 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.