DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15864 and p4ha1

Sequence 1:NP_652183.2 Gene:CG15864 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_017951433.1 Gene:p4ha1 XenbaseID:XB-GENE-987760 Length:526 Species:Xenopus tropicalis

Alignment Length:539 Identity:156/540 (29%)
Similarity:243/540 (45%) Gaps:92/540 (17%)


  Fly     7 LTLIGFLSACFINCQGFVKSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSL 71
            |.|:|..|....:            :..|...:..||..|.:||.:||.|:|..:.|...:::..
 Frog     7 LPLLGLFSCAHAD------------FFTSIGHMTDLLNTEKDLVTSLKDYIKAEEQKLAQIKKWA 59

  Fly    72 IDMSRENMEMKSDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNAL-----GHIENARLMR 131
            ..:.........|.|.|||:|:|:|:|:.||:|.|       :|:||..|     |.|.|..:.|
 Frog    60 DKLDHLTDTATKDPEGYLGHPVNAFKLMKRLNTEW-------VKLENLILKDISDGFISNLTIQR 117

  Fly   132 KMLPTSSDLQQACRGIHDLMSFYDLKPEELAAGNLAGYSQPGTGLTAYDCLALGEFSVQKREDDL 196
            :..|...|...|.:.:..|...|:|..:.::.|||.|.... |.|||.||..||:.:....:...
 Frog   118 QYFPNDEDQTGAAKALLRLQDTYNLDTDTISKGNLPGVKHK-TSLTAEDCFDLGKTAYTDADYYH 181

  Fly   197 AEAWYNLSLIRF----ENKFDK--------YRVHKAWGLLLAKNKQLTDAFYHFENKPEGIIASN 249
            .|.|...:|.:.    |:..||        |.|::...|    :|.||......|..||....:.
 Frog   182 TELWMEQALSQLDAGEESSLDKVMVLDYLSYAVYQQGDL----DKALTLTKRSLELDPEHQRGNG 242

  Fly   250 EVIHFKEELSTKQNCA---------------------------------VVVQKPSRLHCRY-NT 280
            .:.|...:.|.|.:.:                                 :..::..||.||| :.
 Frog   243 NLRHIMSKESNKSSSSPSEGAELRTRKGRPKDHLEKEKYEKLCRGEGVKMTSRRQKRLFCRYFDG 307

  Fly   281 TTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGM-------LNSSNFGLSLTDSGQKSEVRT 338
            ...|...::|.|.|:....|.:|.:||:|.|.||..:       |..:.....:|...:.::.|.
 Frog   308 KKDPLLILSPTKQEDEWDKPRIVRYHDIISDEEISKVKELAKPRLRRATISNPITGVLETAQYRI 372

  Fly   339 SKDSYI------VDAKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDF-HEYTNTTRPK- 395
            :|.:::      |.|: ||.|:..:||..|..::...:.|||:||.|..|:|| .:|......| 
 Frog   373 TKSAWLSGYEDPVVAR-LNRRIEGVTGLDMSTAEELQVANYGIGGQYEPHFDFLRKYEPDAFKKL 436

  Fly   396 -QGDRIATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGS 459
             .|:|:||.|||:.:|::||||:||.:...|.||||:|||||||..||..:..:.|:||||:.|:
 Frog   437 GTGNRVATWLFYMSDVEAGGATVFPEVGAAVYPKKGTAVFWYNLLESGEGDYSTRHAACPVLVGN 501

  Fly   460 KYVLTKWINELPQMFVTPC 478
            |:|..|||:|..|.|..||
 Frog   502 KWVSNKWIHERGQEFRRPC 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 40/136 (29%)
metallo-dependent_hydrolases <237..>306 CDD:294200 17/103 (17%)
P4Hc 313..467 CDD:214780 63/170 (37%)
p4ha1XP_017951433.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.